@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0768: (2016-03-18 )
MAIVNKVIIVEGKSDKKRVQQVIAEPVNIICTHGTMSIDKLDDMIESLYDKQVFVLADSDDEGDRIRNWFKRYLSESEHIFIDKTYCQVANCPKQYLAHVLSKHGFTCKKETPLLPNINNERLVLVNE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MES_C_8(2I5R)
?
[Raw transfer]




MES_C_6(2FCJ)
?
[Raw transfer]




NACID_B_1(1I7D)
TOP3_ECOLI
[Raw transfer]

-

1 PsiBlast_PDB 99.5143%-131 - C2 -2I5R - ? -
2 PsiBlast_PDB 97.6543%-125 - C2 -2FCJ - ? -
25 HHSearch 96.9545%-130 - C2 -2FCJ - ? -
21 PsiBlast_CBE 96.9043%-117 - C2 -2I5R 3.0 ?
24 PsiBlast_CBE 96.6543%-119 - C2 -2FCJ - ? -
23 PsiBlast_CBE 94.8843%-118 - C2 -2FCJ 3.0 ?
22 PsiBlast_CBE 72.1843% -45 - C- -2I5R - ? -
37 HHSearch 58.7329% -95 - C2 -2P62 - ? -
27 HHSearch 58.3021% -93 - C2 -2AU3 - DNAG_AQUAE -
28 HHSearch 57.9916% -97 - C2 -1DD9 - DNAG_ECOLI -
33 HHSearch 57.7314%-109 * C2 *2GAI - TOP1_THEMA -
32 HHSearch 48.5816% -73 - C2 -3VDP - RECR_CALS4 -
52 Fugue 47.8814% -97 - C2 -1S3L - P936_METJA -
31 HHSearch 47.5316% -69 - C2 -1VDD - RECR_DEIRA -
56 Fugue 46.4517% -68 - C2 -2ZJT - GYRB_MYCTU -
51 Fugue 46.1322% -76 - C4 -2FOK - T2F1_PLAOK -
30 HHSearch 45.5315% -73 - C2 -1Q57 - PRIM_BPT7 -
39 HHSearch 42.1316% -62 - C2 -1D3Y - TOP6A_METJA -
38 HHSearch 41.7415% -75 - C2 -2Q2E - TOP6A_METMA -
40 HHSearch 40.7917% -76 - C2 -2ZBK - TOP6A_SULSH -