@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA2124: (2016-04-01 )
MLKSINHICFSVRNLNDSIHFYRDILLGKLLLTGKKTAYFELAGLWIALNEEKDIPRNEIHFSYTHIAFTIDDSEFKYWHQRLKDNNVNILEGRVRDIRDRQSIYFTDPDGHKLELHTGTLENRLNYYKEAKPHMTFYK

Atome Classification :

(36 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

1KM_A_4(4JH9)
FOSB_BACC1
[Raw transfer]




1KM_B_9(4JH7)
FOSB_BACC1
[Raw transfer]




1KM_A_6(4JH7)
FOSB_BACC1
[Raw transfer]




1KM_B_6(4JH9)
FOSB_BACC1
[Raw transfer]




FCN_A_4(4JH4)
FOSB_BACC1
[Raw transfer]




FCN_A_4(4JD1)
FOSB2_BACAN
[Raw transfer]




FCN_A_6(4JH8)
FOSB_BACC1
[Raw transfer]




FCN_B_7(4JD1)
FOSB2_BACAN
[Raw transfer]




FCN_B_11(4JH8)
FOSB_BACC1
[Raw transfer]




FCN_A_4(4JH5)
FOSB_BACC1
[Raw transfer]




FCN_B_9(4JH6)
FOSB_BACC1
[Raw transfer]




FCN_B_8(4JH5)
FOSB_BACC1
[Raw transfer]




FCN_A_4(4IR0)
FOSB2_BACAN
[Raw transfer]




FCN_B_11(4JH3)
FOSB_BACC1
[Raw transfer]




FCN_A_6(4JH3)
FOSB_BACC1
[Raw transfer]




FCN_A_4(4JH6)
FOSB_BACC1
[Raw transfer]




FCN_B_6(4JH4)
FOSB_BACC1
[Raw transfer]




GG6_D_15(2P7Q)
?
[Raw transfer]




PPF_A_7(1NKI)
FOSA_PSEAE
[Raw transfer]




PPF_B_8(1NKI)
FOSA_PSEAE
[Raw transfer]




PPF_A_7(1NKI)
FOSA_PSEAE
[Raw transfer]




GG6_A_14(2P7Q)
?
[Raw transfer]




FMT_B_11(4JH2)
FOSB_BACC1
[Raw transfer]




GG6_E_18(2P7Q)
?
[Raw transfer]




GG6_F_17(2P7Q)
?
[Raw transfer]




GG6_C_16(2P7Q)
?
[Raw transfer]




GG6_B_13(2P7Q)
?
[Raw transfer]




GOL_B_7(2P7L)
FOSX_LISMO
[Raw transfer]




CIT_C_3(2P7K)
FOSX_LISMO
[Raw transfer]




CIT_D_4(2P7K)
FOSX_LISMO
[Raw transfer]




CYS_B_4(4NB0)
FOSB_STAAN
[Raw transfer]




CYS_B_5(4NB1)
FOSB_STAAN
[Raw transfer]




EDO_B_9(4IR0)
FOSB2_BACAN
[Raw transfer]




22 PsiBlast_CBE 93.82100%-136 - C1 -4NB1 3.6 FOSB_STAAN
21 PsiBlast_CBE 92.97100%-135 - C1 -4NB2 - FOSB_STAAN -
23 PsiBlast_CBE 91.38100%-131 - C1 -4NB0 3.4 FOSB_STAAN
1 PsiBlast_PDB 90.71100%-147 - C1 -4NB1 - FOSB_STAAN -
7 PsiBlast_PDB 84.9363%-116 - C1 -4JH4 3.1 FOSB_BACC1
10 PsiBlast_PDB 84.6763%-116 - C1 -4JH1 - FOSB_BACC1 -
5 PsiBlast_PDB 84.5863%-117 - C1 -4JH6 3.1 FOSB_BACC1
4 PsiBlast_PDB 84.3763%-118 - C1 -4JH7 3.3 FOSB_BACC1
3 PsiBlast_PDB 84.3463%-112 - C1 -4JH8 3.1 FOSB_BACC1
30 PsiBlast_CBE 83.9763%-119 - C1 -4JH3 3.1 FOSB_BACC1
33 PsiBlast_CBE 83.9465%-104 - C1 -4JD1 3.2 FOSB2_BACAN
11 PsiBlast_PDB 83.8665%-113 - C1 -4JD1 3.1 FOSB2_BACAN
9 PsiBlast_PDB 83.8063%-115 - C1 -4JH2 - FOSB_BACC1 -
27 PsiBlast_CBE 83.6363%-111 - C1 -4JH6 3.3 FOSB_BACC1
2 PsiBlast_PDB 83.6163%-114 - C1 -4JH9 3.1 FOSB_BACC1
29 PsiBlast_CBE 83.3363%-112 - C1 -4JH4 2.8 FOSB_BACC1
8 PsiBlast_PDB 83.2263%-111 - C1 -4JH3 3.2 FOSB_BACC1
28 PsiBlast_CBE 83.1963%-110 - C1 -4JH5 2.8 FOSB_BACC1
6 PsiBlast_PDB 83.0663%-112 - C1 -4JH5 3.1 FOSB_BACC1
12 PsiBlast_PDB 83.0564%-112 - C1 -4IR0 2.9 FOSB2_BACAN
25 PsiBlast_CBE 82.9763%-108 - C1 -4JH8 2.9 FOSB_BACC1
24 PsiBlast_CBE 82.8963%-112 - C1 -4JH9 3.2 FOSB_BACC1
31 PsiBlast_CBE 82.6063%-108 - C1 -4JH2 3.2 FOSB_BACC1
26 PsiBlast_CBE 82.5363%-110 - C1 -4JH7 3.4 FOSB_BACC1
47 PsiBlast_CBE 71.4835%-126 - C1 -2P7Q 3.7 ?
57 PsiBlast_CBE 71.2935%-122 - C1 -2P7L 2.9 FOSX_LISMO
19 PsiBlast_PDB 70.7635%-120 - C1 -2P7Q 2.8 ?
48 PsiBlast_CBE 70.5035%-115 - C1 -2P7Q 4.1 ?
45 PsiBlast_CBE 69.9835%-115 - C1 -2P7Q 4.1 ?
44 PsiBlast_CBE 69.7835%-108 - C1 -2P7Q 4.3 ?
20 PsiBlast_PDB 69.7835%-116 - C1 -2P7K 2.8 FOSX_LISMO
94 HHSearch 69.5737%-107 - C1 -1NKI 3.6 FOSA_PSEAE
59 PsiBlast_CBE 69.2135%-116 - C1 -2P7K 3.2 FOSX_LISMO
40 PsiBlast_CBE 68.8835%-103 - C1 -1NKI 3.8 FOSA_PSEAE
46 PsiBlast_CBE 67.9935%-106 - C1 -2P7Q 4.2 ?
17 PsiBlast_PDB 67.2235%-104 - C1 -1NKI 3.6 FOSA_PSEAE