@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA2466: (2016-04-04 )
MIELWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECVNRIHIVDLIGAKAQYAREFDYIKSLRRLTTKDIEVGGGIRTKSQIMDYFAAGINYCIVGTKGIQDTDWLKEMAHTFPGRIYLSVDAYGEDIKVNGWEEDTELNLFSFVRQLSDIPLGGIIYTDIAKDGKMSGPNFELTGQLVKATTIPVIASGGIRHQQDIQRLASLNVHAAIIGKAAHQASFWEGLE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2ER_A_2(2Y88)
HIS4_MYCTU
[Raw transfer]




1PR_A_2(3ZS4)
HIS4_MYCTU
[Raw transfer]




GUO_A_2(5AHF)
?
[Raw transfer]




137_A_7(2Y85)
HIS4_MYCTU
[Raw transfer]




11 PsiBlast_PDB 93.2528% -88 - C3 -2Y85 5.2 HIS4_MYCTU
12 PsiBlast_PDB 92.6128% -77 - C3 -3ZS4 7.8 HIS4_MYCTU
10 PsiBlast_PDB 92.1927% -83 - C3 -5A5W - ? -
13 PsiBlast_PDB 91.5927% -76 - C3 -2Y88 9.6 HIS4_MYCTU
7 PsiBlast_PDB 91.4129% -79 - C3 -4W9T - ? -
67 HHSearch 91.1228% -85 * C3 *2Y88 - HIS4_MYCTU -
14 PsiBlast_PDB 89.7827% -89 - C3 -2Y89 - HIS4_MYCTU -
3 PsiBlast_PDB 89.5829% -81 - C3 -2VEP - HIS4_STRCO -
2 PsiBlast_PDB 89.4329% -96 - C3 -2X30 - HIS4_STRCO -
1 PsiBlast_PDB 88.3428%-100 - C3 -4WD0 - HIS4_ARTAT -
4 PsiBlast_PDB 86.3528%-100 - C3 -5AHE - ? -
6 PsiBlast_PDB 86.3027%-104 - C3 -5AHF 4.7 ?
17 PsiBlast_PDB 85.3124% -90 - C3 -2CFF - HIS4_THEMA -
19 PsiBlast_PDB 84.4123% -81 - C3 -2W79 - HIS4_THEMA -
18 PsiBlast_PDB 83.9025% -88 - C3 -1H5Y - HIS6_PYRAE -
15 PsiBlast_PDB 82.6027% -88 - C3 -4AXK - HIS4_COREF -
69 HHSearch 76.6719% -90 - C3 -1THF - HIS6_THEMA -
5 PsiBlast_PDB 76.6230% -52 - C3 -4GJ1 - HIS4_CAMJE -
70 HHSearch 73.2621% -79 - C3 -2W6R - HIS6_THEMA -
78 HHSearch 72.5422% -97 - C3 -3CWO - HIS6_THEMA -