@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1082: (2016-03-21 )
MEIVESKLAGVKLVKPKVFGDHRGFFMESYNEKAFHEAGIDMKFIQDNHSLSVEAGVLRGMHYQTNPKAQTKLIRVATGAIYDVVVDMRKGSPTYGEWEGYILSEANKHQLLVPQGFAHGFCTITENVNVLYKVDQLYSPENDAGIAYDDPDLNITWPTDKLILSDKDTKHPRLKDAENNFVWENK

Atome Classification :

(31 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAG_A_4(2PHL)
PHSB_PHAVU
[Raw transfer]




TRH_A_5(2IXC)
RMLC_MYCTU
[Raw transfer]




TRH_C_7(2IXC)
RMLC_MYCTU
[Raw transfer]




TDO_A_3(2IXK)
RMLC_PSEAE
[Raw transfer]




TDO_A_3(2IXK)
RMLC_PSEAE
[Raw transfer]




TRH_D_8(2IXC)
RMLC_MYCTU
[Raw transfer]




TDO_B_4(2IXK)
RMLC_PSEAE
[Raw transfer]




TRH_A_3(2IXH)
RMLC_PSEAE
[Raw transfer]




TRH_B_4(2IXH)
RMLC_PSEAE
[Raw transfer]




TRH_B_6(2IXC)
RMLC_MYCTU
[Raw transfer]




ATY_D_6(1DZT)
RMLC_SALTY
[Raw transfer]




TYD_C_3(1EPZ)
RMLC_METTH
[Raw transfer]




TPE_D_5(1DZT)
RMLC_SALTY
[Raw transfer]




GOL_A_7(1DZR)
RMLC_SALTY
[Raw transfer]




TYD_A_4(3RYK)
?
[Raw transfer]




GOL_A_7(1DZR)
RMLC_SALTY
[Raw transfer]




TYD_B_5(2IXI)
RMLC_PSEAE
[Raw transfer]




GOL_A_7(1DZR)
RMLC_SALTY
[Raw transfer]




GOL_A_7(1DZR)
RMLC_SALTY
[Raw transfer]




SRT_A_3(2IXJ)
RMLC_PSEAE
[Raw transfer]




SRT_C_3(1RTV)
RMLC_PSEAE
[Raw transfer]




TYD_B_14(4HN1)
CHMJ_STRBI
[Raw transfer]




TMP_B_4(1OI6)
?
[Raw transfer]




TYD_A_9(4HN1)
CHMJ_STRBI
[Raw transfer]




TYD_A_3(2IXI)
RMLC_PSEAE
[Raw transfer]




POP_A_3(3RYK)
?
[Raw transfer]




POP_A_3(3RYK)
?
[Raw transfer]




TMP_A_3(1OI6)
?
[Raw transfer]




SRT_A_4(2IXI)
RMLC_PSEAE
[Raw transfer]




GOL_A_3(1OFN)
?
[Raw transfer]




22 PsiBlast_CBE 95.1347% -85 - C4 -2IXK 4.7 RMLC_PSEAE
78 Fugue 94.8446% -86 - C4 -1DZR 3.1 RMLC_SALTY
77 Fugue 94.8446% -86 - C4 -1DZR 3.1 RMLC_SALTY
9 PsiBlast_PDB 94.5347% -91 - C4 -1DZR 3.1 RMLC_SALTY
4 PsiBlast_PDB 94.4847% -87 - C4 -2IXI 4.3 RMLC_PSEAE
23 PsiBlast_CBE 94.4447% -87 - C4 -2IXI 2.7 RMLC_PSEAE
63 HHSearch 94.2947% -90 - C4 -1DZR 3.1 RMLC_SALTY
24 PsiBlast_CBE 94.2147% -88 - C4 -2IXH 5.8 RMLC_PSEAE
3 PsiBlast_PDB 93.9146% -91 - C4 -1EPZ 2.8 RMLC_METTH
5 PsiBlast_PDB 93.9047% -85 - C4 -2IXK 4.5 RMLC_PSEAE
62 HHSearch 93.7947% -88 - C4 -1EP0 - RMLC_METTH -
6 PsiBlast_PDB 93.6247% -84 - C4 -1RTV 3.6 RMLC_PSEAE
10 PsiBlast_PDB 93.5947% -89 - C4 -1DZT 4.1 RMLC_SALTY
8 PsiBlast_PDB 93.5347% -88 - C4 -2IXH 6.2 RMLC_PSEAE
25 PsiBlast_CBE 93.4647% -88 - C4 -1DZT 3.9 RMLC_SALTY
26 PsiBlast_CBE 93.2747% -93 - C4 -1DZR - RMLC_SALTY -
7 PsiBlast_PDB 93.0147% -88 - C4 -2IXJ 3.3 RMLC_PSEAE
60 HHSearch 92.8054% -93 - C4 -3RYK 3.6 ?
2 PsiBlast_PDB 92.6346% -91 - C4 -1EP0 - RMLC_METTH -
61 HHSearch 92.5047% -84 * C4 *2IXK 4.5 RMLC_PSEAE
1 PsiBlast_PDB 92.2854% -90 - C4 -3RYK 3.6 ?
21 PsiBlast_CBE 90.9654% -85 - C4 -3RYK 2.6 ?
28 PsiBlast_CBE 87.7134% -74 - C4 -2IXC 5.7 RMLC_MYCTU
29 PsiBlast_CBE 87.6834% -72 - C4 -2IXC 5.8 RMLC_MYCTU
15 PsiBlast_PDB 87.6034% -72 - C4 -2IXC 6.0 RMLC_MYCTU
27 PsiBlast_CBE 87.1334% -69 - C4 -2IXC 6.1 RMLC_MYCTU
45 PsiBlast_CBE 81.3134% -76 - C4 -4HN1 3.1 CHMJ_STRBI
46 PsiBlast_CBE 80.7334% -77 - C4 -4HN1 3.3 CHMJ_STRBI
39 PsiBlast_CBE 77.0331% -68 - C4 -1OI6 3.3 ?
40 PsiBlast_CBE 76.4031% -71 - C4 -1OI6 3.3 ?
41 PsiBlast_CBE 76.1431% -72 - C4 -1OFN 2.0 ?