@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv3557c: (2016-05-21 )
MDRVAGQVNSRRGELLELAAAMFAERGLRATTVRDIADGAGILSGSLYHHFASKEEMVDELLRGFLDWLFARYRDIVDSTANPLERLQGLFMASFEAIEHHHAQVVIYQDEAQRLASQPRFSYIEDRNKQQRKMWVDVLNQGIEEGYFRPDLDVDLVYRFIRDTTWVSVRWYRPGGPLTAQQVGQQYLAIVLGGITKEGV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DAO_D_6(3ANP)
?
[Raw transfer]




UCA_A_2(4W97)
KSTR2_MYCTU
[Raw transfer]




UCA_A_2(4W97)
KSTR2_MYCTU
[Raw transfer]




2 PsiBlast_PDB 95.10100%-132 - C1 -4W97 9.2 KSTR2_MYCTU
131 HHSearch 94.98100%-133 - C1 -4W97 9.2 KSTR2_MYCTU
1 PsiBlast_PDB 94.64100%-141 - C1 -4W1U - KSTR2_MYCTU -
134 HHSearch 57.5121%-111 * C1 *1VI0 - FADR_BACSU -
5 PsiBlast_PDB 56.8529%-107 - C2 -4MO7 - ? -
144 HHSearch 56.2820%-108 - C1 -3HIM - ? -
123 Fugue 55.6317% -97 - C1 -2PBX - ? -
137 HHSearch 54.9216%-105 - C1 -3G1L - ETHR_MYCTU -
128 Fugue 54.8917% -98 - C1 -1T56 - ETHR_MYCTU -
140 HHSearch 52.9016%-103 - C1 -5EYR - ? -
14 PsiBlast_PDB 52.7024%-109 - C1 -3WHC - FADR_BACSU -
17 PsiBlast_PDB 52.3824%-106 - C1 -1VI0 - FADR_BACSU -
145 HHSearch 51.3814%-107 - C1 -2F07 - YVDT_BACSU -
135 HHSearch 51.2417% -97 - C1 -3PAS - ? -
13 PsiBlast_PDB 50.8324%-110 - C1 -3WHB - FADR_BACSU -
142 HHSearch 50.0018%-105 - C1 -3DEW - ? -
136 HHSearch 49.5713%-109 - C1 -3COL - ? -
124 Fugue 49.1318% -96 - C1 -2UXU - TTGR_PSEPT -
20 PsiBlast_PDB 47.8726%-113 - C2 -2GFN - ? -
150 HHSearch 47.5220% -89 - C1 -3ANP Error ?