@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Wbm0804: (2015-12-04 )
MLNLESLPKHLAIIMDGNSRWANSQGRVKIDGYRKGSEVAYDIAKHCIALAIPYLTLYAFSMENWLRPKEETDCLFDLFYSILTDRDKVNFFHNYNIKLNFVGNLSLLPGKILNQIKESEEMTRKNDGLLLTVAVSYGAKQEIIHAVRNITRKNIDCVSEDEFEKFLYTKDLPKLDLLIRTGGEKRLSNFLLWQAAYAELYFCDTLWPDFSCQDLSKALEDYTKREKRYGR

Atome Classification :

(47 SA) ........----.10........20.......-.30-........40........50........60........70.......---.80........90....-------....100.......110.......120.......130.......140.......150.------.----------...------..-160.......170.-.----.....180.......190.......200.......210.......220.......230
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MLNLESLP----KHLAIIMDGNSRWANSQGRV-KID-GYRKGSEVAYDIAKHCIALAIPYLTLYAFSMENWLRPKEETDCLFDL---FYSILTDRDKVNFFHNY-------NIKLNFVGNLSLLPGKILNQIKESEEMTRKNDGLLLTVAVSYGAKQEIIHAVRNITRK------N----------IDC------VS-EDEFEKFLYTKDLP-K----LDLLIRTGGEKRLSNFLLWQAAYAELYFCDTLWPDFSCQDLSKALEDYTKREKRYGR
4 PsiBlast_PDB 97.6241%-114 - C10 -1X07 UPPS_ECOLI A:[11-240] ----EKLPAHGCRHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE-----
3 PsiBlast_PDB 96.2041%-110 - C10 -1X06 UPPS_ECOLI A:[12-240] -----KLPAHGCRHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE-----
95 HHSearch 96.1040%-114 - C10 -2VG3 DPDS_MYCTU A:[50-283] -IPADRLP----NHVAIVMDGNGRWATQRGLA-RTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGF---NRDVVRRR--RDTLKKL-------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIARE------VAAGRLN----PER------IT-ESTIARHLQRPDIP-D----VDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGS
2 PsiBlast_PDB 96.0841%-116 - C10 -1V7U UPPS_ECOLI A:[13-239] ------LPAHGCRHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANR------
31 PsiBlast_CBE 95.7741%-114 - C10 -2E9D UPPS_ECOLI B:[17-243] --------GC--RHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFSS----------SALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRF--
40 PsiBlast_CBE 95.5540%-109 - C10 -1X08 UPPS_ECOLI A:[13-240] ------LPAHGCRHVAIIMAGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE-----
37 PsiBlast_CBE 95.5341%-112 - C10 -1UEH UPPS_ECOLI B:[17-241] --------GC--RHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRER----
39 PsiBlast_CBE 95.5040%-110 - C10 -1X09 UPPS_ECOLI A:[11-239] ----EKLPAHGCRHVAIIMAGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANR------
13 PsiBlast_PDB 95.1741%-117 - C10 -3SGV UPPS_ECOLI B:[13-240] ------LPAHGCRHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAF-----------VSALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE-----
12 PsiBlast_PDB 95.0441%-114 - C10 -3SGT UPPS_ECOL6 B:[13-240] ------LPAHGCRHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFSSEN---PAQEVSALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE-----
35 PsiBlast_CBE 94.9341%-115 - C10 -2E98 UPPS_ECOLI B:[17-243] --------GC--RHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFSS----------SALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRF--
27 PsiBlast_CBE 94.7641%-117 - C10 -3WYJ UPPS_ECOLI A:[14-240] -------PAHGCRHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFSS-----PAQEVSALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE-----
92 HHSearch 94.5542%-115 * C10 *3SGV UPPS_ECOLI B:[14-240] ---PAHGC----RHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAF-----------VSALMEL---FVWALDSE--VKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEK------VQQGNLQ----PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE-----
51 PsiBlast_CBE 94.4039%-100 - C10 -2VG3 DPDS_MYCTU B:[50-282] -IPADRLP----NHVAIVMDGNGRWATQRGLA-RTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVR--FLM---GFNRDVVRRRRDTLKKL-------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLN----------PER------IT-ESTIARHLQRPDIP-D----VDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGS
1 PsiBlast_PDB 94.3841%-119 - C10 -1UEH UPPS_ECOLI A:[13-240] ------LPAHGCRHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFS--------------MEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE-----
16 PsiBlast_PDB 94.2341%-111 - C10 -4H2J UPPS_ECOLI A:[13-240] ------LPAHGCRHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFSSE-----------LMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE-----
30 PsiBlast_CBE 94.1641%-112 - C10 -3SGV UPPS_ECOLI A:[17-238] --------GC--RHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFAN-------
34 PsiBlast_CBE 94.1541%-115 - C10 -2E99 UPPS_ECOLI B:[17-243] --------GC--RHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFSS----------SALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRF--
25 PsiBlast_CBE 94.1141%-113 - C10 -4H2M UPPS_ECOLI B:[17-239] --------GC--RHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFSSE----------ALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANR------
6 PsiBlast_PDB 94.0841%-110 - C10 -2E99 UPPS_ECOLI A:[14-240] -------PAHGCRHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE-----
52 PsiBlast_CBE 93.9239% -98 - C10 -2VG3 DPDS_MYCTU A:[50-282] -IPADRLP----NHVAIVMDGNGRWATQRGLA-RTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVR--FLM---GFNRDVVRRRRDTLKKL-------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLN----------PER------IT-ESTIARHLQRPDIP-D----VDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGS
53 PsiBlast_CBE 93.8439% -99 - C10 -2VG2 DPDS_MYCTU D:[50-282] -IPADRLP----NHVAIVMDGNGRWATQRGLA-RTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVR--FLM---GFNRDVVRRRRDTLKKL-------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLN----------PER------IT-ESTIARHLQRPDIP-D----VDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGS
47 PsiBlast_CBE 93.8439% -99 - C10 -4ONC DPDS_MYCTU B:[50-282] -IPADRLP----NHVAIVMDGNGRWATQRGLA-RTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVR--FLM---GFNRDVVRRRRDTLKKL-------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLN----------PER------IT-ESTIARHLQRPDIP-D----VDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGS
5 PsiBlast_PDB 93.7941%-111 - C10 -2E98 UPPS_ECOLI A:[15-240] --------AHGCRHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE-----
49 PsiBlast_CBE 93.7639%-101 - C10 -2VG3 DPDS_MYCTU D:[50-282] -IPADRLP----NHVAIVMDGNGRWATQRGLA-RTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVR--FLM---GFNRDVVRRRRDTLKKL-------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLN----------PER------IT-ESTIARHLQRPDIP-D----VDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGS
56 PsiBlast_CBE 93.7139% -97 - C10 -2VG2 DPDS_MYCTU A:[50-282] -IPADRLP----NHVAIVMDGNGRWATQRGLA-RTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVR--FLM---GFNRDVVRRRRDTLKKL-------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLN----------PER------IT-ESTIARHLQRPDIP-D----VDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGS
54 PsiBlast_CBE 93.6839% -94 - C10 -2VG2 DPDS_MYCTU C:[50-282] -IPADRLP----NHVAIVMDGNGRWATQRGLA-RTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVR--FLM---GFNRDVVRRRRDTLKKL-------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLN----------PER------IT-ESTIARHLQRPDIP-D----VDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGS
48 PsiBlast_CBE 93.5939% -95 - C10 -4ONC DPDS_MYCTU A:[50-280] -IPADRLP----NHVAIVMDGNGRWATQRGLA-RTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVR--FLM---GFNRDVVRRRRDTLKKL-------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLN----------PER------IT-ESTIARHLQRPDIP-D----VDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRR---
33 PsiBlast_CBE 93.3941%-117 - C10 -2E9A UPPS_ECOLI B:[17-242] --------GC--RHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFS------------ALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERR---
9 PsiBlast_PDB 93.2041%-113 - C10 -2E9D UPPS_ECOLI A:[16-240] --------HGC-RHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFS-------AQEVSALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE-----
50 PsiBlast_CBE 93.1439% -94 - C10 -2VG3 DPDS_MYCTU C:[50-282] -IPADRLP----NHVAIVMDGNGRWATQRGLA-RTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVR--FLM---GFNRDVVRRRRDTLKKL-------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLN----------PER------IT-ESTIARHLQRPDIP-D----VDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGS
7 PsiBlast_PDB 93.0241%-111 - C10 -2E9A UPPS_ECOLI A:[14-240] -------PAHGCRHVAIIMDGNGRWAKKQGKI-RAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFSS---------VSALMEL---FVWALDS--EVKSLHRH-------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQ----------PDQ------ID-EEMLNQHVCMHELA-P----VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE-----
55 PsiBlast_CBE 92.9739%-100 - C10 -2VG2 DPDS_MYCTU B:[50-282] -IPADRLP----NHVAIVMDGNGRWATQRGLA-RTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVR--FLM---GFNRDVVRRRRDTLKKL-------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLN----------PER------IT-ESTIARHLQRPDIP-D----VDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGS
45 PsiBlast_CBE