@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0717: (2015-12-04 )
MAIERTLSILKPDTVKNNIIGNINSYIEKSGLRIIAQKMMLLTKKQAELFYAIHKDRPFFGGLVEFMTSGPVIVQVLVGENAISKYRQIMGATDPKQADKGTIRGDFADDVNENRVHGSDSLENAHKEIAFFFAECELV

Atome Classification :

(73 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_3(4HR2)
NDK_BURTA
[Raw transfer]




GDP_A_8(2DXE)
NDK_PYRHO
[Raw transfer]




ADP_A_5(1WKL)
NDK_THET8
[Raw transfer]




ATP_B_6(1WKL)
NDK_THET8
[Raw transfer]




ADP_E_14(3Q8U)
NDK_STAAC
[Raw transfer]




PPS_A_4(1BUX)
NDKC_DICDI
[Raw transfer]




ADP_G_7(1ZS6)
NDK3_HUMAN
[Raw transfer]




ADP_A_8(1KDN)
NDKC_DICDI
[Raw transfer]




ADP_R_5(1NLK)
NDK_MYXXA
[Raw transfer]




ADP_B_10(2BEF)
NDKC_DICDI
[Raw transfer]




ADP_B_5(1NDP)
NDKC_DICDI
[Raw transfer]




ADP_C_12(2BEF)
NDKC_DICDI
[Raw transfer]




ADP_R_5(1NLK)
NDK_MYXXA
[Raw transfer]




3AN_A_7(1HIY)
NDKC_DICDI
[Raw transfer]




TBD_C_9(1F6T)
NDKC_DICDI
[Raw transfer]




ADP_A_8(2BEF)
NDKC_DICDI
[Raw transfer]




GDP_A_8(2DXE)
NDK_PYRHO
[Raw transfer]




3AN_B_9(1HIY)
NDKC_DICDI
[Raw transfer]




ADP_A_4(1NDP)
NDKC_DICDI
[Raw transfer]




ADP_C_12(1KDN)
NDKC_DICDI
[Raw transfer]




ADP_B_10(1KDN)
NDKC_DICDI
[Raw transfer]




ADP_A_8(2DY9)
NDK_PYRHO
[Raw transfer]




UDP_D_13(3Q8V)
NDK_STAAC
[Raw transfer]




TYD_A_3(1NDC)
NDKC_DICDI
[Raw transfer]




ADP_B_4(4HR2)
NDK_BURTA
[Raw transfer]




PPS_B_5(1BUX)
NDKC_DICDI
[Raw transfer]




TYD_A_3(3EVO)
NDK_MIMIV
[Raw transfer]




UDP_B_11(3Q8V)
NDK_STAAC
[Raw transfer]




TBD_A_7(1F6T)
NDKC_DICDI
[Raw transfer]




UDP_A_9(3Q8V)
NDK_STAAC
[Raw transfer]




ADP_B_10(2DYA)
NDK_PYRHO
[Raw transfer]




3AN_C_11(1HIY)
NDKC_DICDI
[Raw transfer]




CIT_A_7(4ANE)
NDK_MYCTU
[Raw transfer]




GDP_G_7(1WKK)
NDK_THET8
[Raw transfer]




ADP_A_9(2DYA)
NDK_PYRHO
[Raw transfer]




ADP_F_16(3Q8U)
NDK_STAAC
[Raw transfer]




SON_H_8(1S5Z)
NDKC_DICDI
[Raw transfer]




PPS_C_6(1BUX)
NDKC_DICDI
[Raw transfer]




CIT_F_9(4ANE)
NDK_MYCTU
[Raw transfer]




ADP_H_24(3Q8Y)
NDK_STAAC
[Raw transfer]




POP_H_8(1B99)
NDKC_DICDI
[Raw transfer]




ADP_A_7(3Q8U)
NDK_STAAC
[Raw transfer]




TBD_B_8(1F6T)
NDKC_DICDI
[Raw transfer]




CIT_D_8(4ANE)
NDK_MYCTU
[Raw transfer]




GNP_A_7(2DXF)
NDK_PYRHO
[Raw transfer]




ADP_D_15(3Q8Y)
NDK_STAAC
[Raw transfer]




CMP_R_3(1NHK)
NDK_MYXXA
[Raw transfer]




FUP_G_7(1B99)
NDKC_DICDI
[Raw transfer]




ADP_A_9(3Q8Y)
NDK_STAAC
[Raw transfer]




ADP_E_18(3Q8Y)
NDK_STAAC
[Raw transfer]




CMP_R_3(1NHK)
NDK_MYXXA
[Raw transfer]




CMP_L_4(1NHK)
NDK_MYXXA
[Raw transfer]




ADP_G_22(3Q8Y)
NDK_STAAC
[Raw transfer]




POP_I_9(1B99)
NDKC_DICDI
[Raw transfer]




ANP_A_5(2DXD)
NDK_PYRHO
[Raw transfer]




POP_L_12(1B99)
NDKC_DICDI
[Raw transfer]




POP_J_10(1B99)
NDKC_DICDI
[Raw transfer]




POP_K_11(1B99)
NDKC_DICDI
[Raw transfer]




ANP_B_6(2DXD)
NDK_PYRHO
[Raw transfer]




ADP_B_11(3Q8Y)
NDK_STAAC
[Raw transfer]




EDO_B_7(4EK2)
NDK_BURTA
[Raw transfer]




1 PsiBlast_PDB 94.6763% -88 - C8 -3VGU - ? -
25 PsiBlast_CBE 94.1859% -84 - C8 -4S0M - ? -
8 PsiBlast_PDB 94.1259% -87 - C8 -4S0M - ? -
3 PsiBlast_PDB 94.0562% -82 - C8 -3VGS - ? -
6 PsiBlast_PDB 93.2860% -85 - C8 -4EK2 - NDK_BURTA -
9 PsiBlast_PDB 92.9959% -84 - C8 -4W98 - NDK_ACIBS -
24 PsiBlast_CBE 92.8559% -87 - C8 -4S0M - ? -
4 PsiBlast_PDB 92.6762% -89 - C8 -3VGT - ? -
2 PsiBlast_PDB 92.1663% -84 - C8 -3VGV - ? -
10 PsiBlast_PDB 91.6059% -88 - C8 -4WBF - NDK_ACIBS -
13 PsiBlast_PDB 91.2558% -82 - C8 -2NCK - NDK_MYXXA -
21 PsiBlast_CBE 91.1560% -84 - C8 -4HR2 5.8 NDK_BURTA
123 Fugue 91.0257% -85 - C8 -1NLK 5.7 NDK_MYXXA
35 PsiBlast_CBE 91.0258% -84 - C8 -1NHK 5.9 NDK_MYXXA
22 PsiBlast_CBE 90.6760% -83 - C8 -4EK2 3.3 NDK_BURTA
15 PsiBlast_PDB 90.6458% -83 - C8 -1NHK 5.6 NDK_MYXXA
14 PsiBlast_PDB 90.2658% -83 - C8 -1NLK 5.7 NDK_MYXXA
109 HHSearch 90.1458% -82 - C8 -1NHK 5.6 NDK_MYXXA
7 PsiBlast_PDB 89.9060% -85 - C8 -4HR2 7.9 NDK_BURTA
32 PsiBlast_CBE 89.4855% -87 - C8 -2HUR - NDK_ECOLI -
19 PsiBlast_PDB 88.2048% -89 - C8 -1WKK 5.0 NDK_THET8
84 PsiBlast_CBE 87.5347% -90 - C8 -2DXF 3.9 NDK_PYRHO
86 PsiBlast_CBE 87.2347% -89 - C8 -2DXE 5.9 NDK_PYRHO
20 PsiBlast_PDB 87.1948% -92 - C8 -1WKL 5.6 NDK_THET8
80 PsiBlast_CBE 87.0547% -89 - C8 -2DYA 6.6 NDK_PYRHO
79 PsiBlast_CBE 86.9647% -89 - C8 -2DYA 5.6 NDK_PYRHO
87 PsiBlast_CBE 86.8047% -90 - C8 -2DXD 5.0 NDK_PYRHO
48 PsiBlast_CBE 86.7646% -88 - C8 -1NDC 7.0 NDKC_DICDI
49 PsiBlast_CBE 86.5346% -85 - C8 -1KDN 6.9 NDKC_DICDI
88 PsiBlast_CBE 86.4347% -92 - C8 -2DXD 4.5 NDK_PYRHO
82 PsiBlast_CBE 86.4147% -89 - C8 -2DY9 6.1 NDK_PYRHO
36 PsiBlast_CBE 86.3948% -89 - C8 -1WKL 6.0 NDK_THET8
61 PsiBlast_CBE 86.2046% -89 - C8 -1B99 3.5 NDKC_DICDI
64 PsiBlast_CBE 85.7346% -88 - C8 -1B99 2.1 NDKC_DICDI
95 PsiBlast_CBE 85.5643% -90 - C8 -3Q8Y 4.8 NDK_STAAC
60 PsiBlast_CBE 85.5546% -90 - C8 -1BUX 6.5 NDKC_DICDI
55 PsiBlast_CBE 85.3346% -84 - C8 -1F6T 6.8 NDKC_DICDI
90 PsiBlast_CBE 85.2843% -90 - C8 -3Q8Y 6.3 NDK_STAAC
62 PsiBlast_CBE 85.2546% -89 - C8 -1B99 3.3 NDKC_DICDI
40 PsiBlast_CBE 85.2146% -83 - C8 -2BEF 7.2 NDKC_DICDI
53 PsiBlast_CBE 85.1946% -87 - C8 -1HIY 4.9 NDKC_DICDI
63 PsiBlast_CBE 85.1146% -90 - C8 -1B99 3.7 NDKC_DICDI
93 PsiBlast_CBE 85.0943% -88 - C8 -3Q8Y 4.8 NDK_STAAC
101 PsiBlast_CBE 85.0343% -87 - C8 -3Q8U 6.5 NDK_STAAC
46 PsiBlast_CBE 84.9746% -83 - C8 -1NDP 7.7 NDKC_DICDI
65 PsiBlast_CBE 84.9346% -84 - C8 -1B99 3.2 NDKC_DICDI
52 PsiBlast_CBE 84.7846% -91 - C8 -1HIY 5.5 NDKC_DICDI
97 PsiBlast_CBE 84.7043% -88 - C8 -3Q8V 4.9 NDK_STAAC
115 HHSearch 84.6542% -86 - C8 -1ZS6 6.9 NDK3_HUMAN
51 PsiBlast_CBE 84.6446% -83 - C8 -1KDN 7.1 NDKC_DICDI
50 PsiBlast_CBE 84.5346% -84 - C8 -1KDN 6.3 NDKC_DICDI
122 HHSearch 84.2747% -88 - C8 -2DXE 7.3 NDK_PYRHO
66 PsiBlast_CBE 84.1346% -88 - C8 -1B99 5.1 NDKC_DICDI
42 PsiBlast_CBE 84.0946% -83 - C8 -2BEF 7.0 NDKC_DICDI
100 PsiBlast_CBE 84.0743% -83 - C8 -3Q8U 6.4 NDK_STAAC
58 PsiBlast_CBE 83.8746% -88 - C8 -1BUX 5.1 NDKC_DICDI
41 PsiBlast_CBE 83.8646% -81 - C8 -2BEF 5.8 NDKC_DICDI
99 PsiBlast_CBE 83.4743% -86 - C8 -3Q8V 5.3 NDK_STAAC
47 PsiBlast_CBE 83.2246% -83 - C8 -1NDP 7.2 NDKC_DICDI
89 PsiBlast_CBE 83.1643% -91 - C8 -3Q8Y 4.7 NDK_STAAC
54 PsiBlast_CBE 83.1046% -87 - C8 -1HIY 5.9 NDKC_DICDI
117 HHSearch 82.7643% -84 - C8 -3Q8U 6.6 NDK_STAAC
98 PsiBlast_CBE 82.7143% -87 - C8 -3Q8V 4.7 NDK_STAAC
39 PsiBlast_CBE 82.6750% -78 - C8 -4ANE 3.1 NDK_MYCTU
96 PsiBlast_CBE 82.4443% -90 - C8 -3Q8Y 5.4 NDK_STAAC
38 PsiBlast_CBE 82.1650% -77 - C8 -4ANE 3.5 NDK_MYCTU
56 PsiBlast_CBE 81.9646% -82 - C8 -1F6T 6.9 NDKC_DICDI
92 PsiBlast_CBE 81.8043% -89 - C8 -3Q8Y 5.9 NDK_STAAC
45 PsiBlast_CBE 81.6846% -86 - C8 -1S5Z 5.0 NDKC_DICDI
57 PsiBlast_CBE 80.9346% -83 - C8 -1F6T 6.9 NDKC_DICDI
59 PsiBlast_CBE 80.8546% -85 - C8 -1BUX 5.5 NDKC_DICDI
37 PsiBlast_CBE 80.5850% -75 - C8 -4ANE 3.4 NDK_MYCTU
110 HHSearch 77.8837% -75 - C8 -3EVO 4.7 NDK_MIMIV