@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA2456: (2016-04-04 )
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDMRKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPPVNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_B_6(3BFV)
CAP8A_STAAU
[Raw transfer]




ADP_A_5(3BFV)
CAP8A_STAAU
[Raw transfer]




ADP_B_5(2VED)
?
[Raw transfer]




ADP_A_3(2VED)
?
[Raw transfer]




1 PsiBlast_PDB 93.4299% -98 - C1 -3BFV 6.9 CAP8A_STAAU
2 PsiBlast_PDB 92.9299% -97 - C1 -2VED 6.8 ?
21 PsiBlast_CBE 92.4699% -96 - C1 -3BFV 6.9 CAP8A_STAAU
22 PsiBlast_CBE 91.9499% -98 - C1 -2VED 5.9 ?
85 Fugue 67.3128% -83 - C1 -3CIO - ETK_ECOLI -
94 HHSearch 67.2632% -84 - C1 -3LA6 - WZC_ECOLI -
95 HHSearch 65.4930% -87 - C1 -3CIO - ETK_ECOLI -
3 PsiBlast_PDB 65.3130% -87 - C1 -3CIO - ETK_ECOLI -
7 PsiBlast_PDB 58.0627% -83 - C1 -1G3R - ? -
96 HHSearch 58.0125% -76 - C1 -1G3Q - ? -
6 PsiBlast_PDB 57.7427% -82 - C1 -1G3Q - ? -
4 PsiBlast_PDB 57.4427% -86 - C1 -1ION - ? -
16 PsiBlast_PDB 54.8323% -80 - C2 -5AUQ - ? -
8 PsiBlast_PDB 54.1230% -66 * C2 *2PH1 - ? -
93 Fugue 54.0120% -95 - C1 -3K9G - ? -
101 HHSearch 53.6621% -83 * C1 *3Q9L - MIND_ECOLI -
12 PsiBlast_PDB 52.7223% -78 - C2 -3VX3 - ? -
97 HHSearch 52.0325% -84 - C1 -1HYQ - ? -
105 HHSearch 51.9621% -78 - C1 -3K9G - ? -
5 PsiBlast_PDB 51.1929% -85 - C1 -1HYQ - ? -