@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0640: (2015-12-17 )
MSDFKVPPKAKGFKRLFKALFYSKDGLKCAWAEESAFRQIVILALFCIVLASYLTKDFLEWGLLILPCFLSVVIELINSSIEKAVDFTGTEFHPLAKKAKDMASSAQLIGLIFWAFIWGRYLLTLYFN

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACP_C_8(4CK0)
KDGL_ECOLI
[Raw transfer]



78N_B_13(3ZE3)
KDGL_ECOLI
[Raw transfer]
1 PsiBlast_PDB 87.6941%-143 - C3 -3ZE3 - KDGL_ECOLI -
53 HHSearch 86.8239%-145 - C3 -3ZE3 1.9 KDGL_ECOLI
4 PsiBlast_PDB 86.0841%-141 - C3 -4BRR - KDGL_ECOLI -
5 PsiBlast_PDB 85.5141%-140 - C3 -4D2E - KDGL_ECOLI -
3 PsiBlast_PDB 85.2941%-138 - C3 -4BRB - KDGL_ECOLI -
2 PsiBlast_PDB 85.2841%-139 - C3 -4BPD - KDGL_ECOLI -
42 PsiBlast_CBE 84.9940%-126 - C3 -4CJZ - KDGL_ECOLI -
11 PsiBlast_PDB 84.7040%-129 - C3 -4CK0 - KDGL_ECOLI -
10 PsiBlast_PDB 84.2440%-132 - C3 -4CJZ - KDGL_ECOLI -
41 PsiBlast_CBE 84.0840%-138 - C3 -4CJZ - KDGL_ECOLI -
31 PsiBlast_CBE 83.7841%-129 - C3 -4BPD - KDGL_ECOLI -
28 PsiBlast_CBE 83.3841%-127 - C3 -4BRB - KDGL_ECOLI -
36 PsiBlast_CBE 83.3341%-127 - C3 -3ZE3 - KDGL_ECOLI -
7 PsiBlast_PDB 83.3340%-129 - C3 -4UP6 - KDGL_ECOLI -
22 PsiBlast_CBE 82.7741%-128 - C3 -4D2E - KDGL_ECOLI -
30 PsiBlast_CBE 82.7541%-157 - C3 -4BRB - KDGL_ECOLI -
25 PsiBlast_CBE 82.6541%-126 - C3 -4BRR - KDGL_ECOLI -
38 PsiBlast_CBE 82.4641%-154 - C3 -3ZE3 - KDGL_ECOLI -
6 PsiBlast_PDB 82.2640%-130 - C3 -3ZE4 - KDGL_ECOLI -
40 PsiBlast_CBE 81.9940%-126 - C3 -4CK0 - KDGL_ECOLI -
39 PsiBlast_CBE 80.5640%-129 - C3 -4CK0 4.2 KDGL_ECOLI