@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1029: (2016-03-20 )
MSKIVFFDVDGTLVGETKEIPASAKQAIAKLKENGVYVAIATGRGPFMLDEIRKELDINSYICYNGQYVIFEGKEIYAKPLPTESLERLITVASEHEHPIVFSGKDSMRANLPDHDRVTIGMNSIKREYPKVDANYYKGRDIYQCLLFCDESYDAYYREEFKQYGFLRWHDVSVDVCPADGSKAEGIKQMIKKLGFSMKDTYAFGDGLNDIAMLQTVGTGVAMGNGRDEVKAVADYVTSHVDDDGVYNALKQLKLI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

WO6_A_3(2RAV)
?
[Raw transfer]




WO6_A_3(2RB5)
?
[Raw transfer]




VN4_A_3(2RBK)
?
[Raw transfer]




VN4_A_3(2RBK)
?
[Raw transfer]




VN4_A_3(2RAR)
?
[Raw transfer]




GOL_A_7(3PGV)
?
[Raw transfer]




2 PsiBlast_PDB 95.2451%-114 - C1 -2QYH - ? -
3 PsiBlast_PDB 78.7030% -88 - C1 -1YMQ - ? -
8 PsiBlast_PDB 78.5631%-105 - C1 -3R4C - ? -
112 HHSearch 78.4830% -94 - C1 -2RBK 2.6 ?
7 PsiBlast_PDB 78.3830% -89 - C1 -2RAV 2.8 ?
4 PsiBlast_PDB 78.1430% -87 - C1 -2RB5 2.8 ?
122 HHSearch 78.0629%-102 - C1 -3R4C - ? -
5 PsiBlast_PDB 77.6530% -88 - C1 -2RBK 2.8 ?
6 PsiBlast_PDB 77.2130% -87 - C1 -2RAR 2.8 ?
9 PsiBlast_PDB 74.2925% -86 - C1 -3FZQ - ? -
109 HHSearch 74.0126% -93 - C1 -3FZQ - ? -
1 PsiBlast_PDB 71.9951% -12 - C1 -2PQ0 - ? -
10 PsiBlast_PDB 71.8926% -97 - C1 -4DW8 - ? -
121 HHSearch 70.8351% -9 - C1 -2PQ0 - ? -
11 PsiBlast_PDB 70.3725% -86 - C1 -3NIW - ? -
16 PsiBlast_PDB 70.0625% -91 - C1 -3PGV - ? -
118 HHSearch 68.9924% -88 - C1 -3PGV 3.2 ?
115 HHSearch 68.8626% -88 - C1 -1RKQ - YIDA_ECOLI -
116 HHSearch 67.9621% -88 - C1 -3DNP - YHAX_BACSU -
119 HHSearch 66.4223% -94 - C1 -1NF2 - ? -