@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1404: (2015-12-07 )
MIKPIVRDTFFLQQKSQMASRADVSLAKDLQDTLHANQNYCVGMAANMIGSLKRVIIINVGITNLVMFNPVLVAKSDPYETEESCLSLVGCRSTQRYRHITISYRDINWKEQQIKLTDFPAQICQHELDHLEGILI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMT_A_3(1XEO)
DEF_ECOLI
[Raw transfer]




101 HHSearch 93.5930%-100 - C5 -2OS0 - DEF_ENTFA -
1 PsiBlast_PDB 91.9333% -95 - C5 -3QU1 - DEF2_VIBCH -
21 PsiBlast_CBE 91.6733% -95 - C5 -3QU1 - DEF2_VIBCH -
4 PsiBlast_PDB 91.5129%-123 - C5 -3G6N - ? -
103 HHSearch 91.4129% -94 - C5 -3E3U - DEF_MYCTU -
98 HHSearch 89.5331% -89 - C5 -1V3Y - DEF_THETH -
3 PsiBlast_PDB 89.3129%-118 - C5 -3CMD - ? -
77 PsiBlast_CBE 89.2531% -88 - C5 -3U04 - ? -
104 HHSearch 89.0929%-100 - C5 -3PN3 - DEF1B_ARATH -
100 HHSearch 89.0632% -97 - C5 -3U04 - ? -
9 PsiBlast_PDB 88.8830% -94 - C5 -2AI9 - DEF_STAAU -
5 PsiBlast_PDB 88.3829%-102 - C5 -4DR9 - ? -
8 PsiBlast_PDB 88.3330% -97 - C5 -1LQW - DEF_STAAU -
107 HHSearch 88.1429% -92 - C5 -2OKL - DEF2_BACCR -
94 HHSearch 88.1030% -88 - C5 -3QU1 - DEF2_VIBCH -
95 HHSearch 87.7628% -98 - C5 -1Y6H - DEF_LEPIN -
6 PsiBlast_PDB 87.6829% -94 - C5 -4DR8 - ? -
93 HHSearch 86.6726%-102 - C5 -1WS0 - DEF1_BACCR -
7 PsiBlast_PDB 86.3928% -81 - C5 -1LME - DEF_THEMA -
30 PsiBlast_CBE 84.6732%-104 - C5 -4AL2 - DEF_ECOLI -