@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00530: (2016-06-02 )
MLVIAGLGNPGKNYENTRHNVGFMVIDQLAKEWNIELNQNKFNGLYGTGFVSGKKVLLVKPLTYMNLSGECLRPLMDYYDVDNEDLTVIYDDLDLPTGKIRLRTKGSAGGHNGIKSLIQHLGTSEFDRIRIGIGRPVNGMKVVDYVLGSFTKEEAPEIEEAVDKSVKACEASLSKPFLEVMNEFNAKV

Atome Classification :

(32 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

0L1_A_3(4DHW)
PTH_PSEAE
[Raw transfer]




PML_B_4(4DJJ)
PTH_PSEAE
[Raw transfer]




0L1_B_4(4DHW)
PTH_PSEAE
[Raw transfer]




PEG_B_4(4ERX)
PTH_PSEAE
[Raw transfer]




3NZ_A_3(4QBK)
PTH_PSEAE
[Raw transfer]




5AE_A_2(4QD3)
PTH_PSEAE
[Raw transfer]




PML_A_3(4DJJ)
PTH_PSEAE
[Raw transfer]




GOL_B_8(4FNO)
PTH_PSEAE
[Raw transfer]




PEG_A_3(4ERX)
PTH_PSEAE
[Raw transfer]




EDO_A_4(3NEA)
PTH_FRATT
[Raw transfer]




EDO_A_4(3NEA)
PTH_FRATT
[Raw transfer]




BME_A_10(3KK0)
PTH_MYCS2
[Raw transfer]




21 PsiBlast_CBE 98.3052%-106 - C6 -4YLY - PTH_STAAU -
52 HHSearch 97.8953%-112 - C6 -4YLY - PTH_STAAU -
1 PsiBlast_PDB 97.3952%-111 - C6 -4YLY - PTH_STAAU -
2 PsiBlast_PDB 95.5648%-105 - C6 -4QT4 - PTH_STRPZ -
55 HHSearch 95.0548%-110 - C6 -4QT4 - PTH_STRPZ -
42 Fugue 94.1448%-107 - C6 -4QT4 - PTH_STRPZ -
54 HHSearch 92.1039%-100 - C6 -4LWR - ? -
25 PsiBlast_CBE 92.0539%-100 - C6 -4OLJ - ? -
3 PsiBlast_PDB 91.8145%-114 - C6 -1RYN - CRS2_MAIZE -
23 PsiBlast_CBE 91.6239% -99 - C6 -4JX9 - ? -
15 PsiBlast_PDB 91.6139% -99 - C6 -4LWR - ? -
57 HHSearch 91.5042%-110 - C6 -1RYB - CRS2_MAIZE -
14 PsiBlast_PDB 91.4139%-100 - C6 -4LWQ - ? -
24 PsiBlast_CBE 91.3539%-101 - C6 -4JWK - ? -
16 PsiBlast_PDB 91.3039%-100 - C6 -3WH4 - ? -
22 PsiBlast_CBE 90.9239%-103 - C6 -4JY7 - ? -
19 PsiBlast_PDB 90.7139%-101 - C6 -4HOY - ? -
5 PsiBlast_PDB 90.2943%-109 - C6 -1RYB - CRS2_MAIZE -
17 PsiBlast_PDB 90.2239%-102 - C6 -4FOP - ? -
18 PsiBlast_PDB 90.0939%-101 - C6 -4FOT - ? -
39 PsiBlast_CBE 88.2734% -96 - C6 -4DHW 2.9 PTH_PSEAE
32 PsiBlast_CBE 87.9034% -94 - C6 -4FNO 2.9 PTH_PSEAE
60 HHSearch 87.6436%-104 - C6 -3NEA 3.0 PTH_FRATT
38 PsiBlast_CBE 87.3834% -97 - C6 -4DHW 3.1 PTH_PSEAE
29 PsiBlast_CBE 87.1434% -95 - C6 -4QD3 3.6 PTH_PSEAE
36 PsiBlast_CBE 86.8834% -94 - C6 -4DJJ 3.4 PTH_PSEAE
26 PsiBlast_CBE 86.6739% -94 - C6 -3KK0 2.5 PTH_MYCS2
35 PsiBlast_CBE 86.2534% -96 - C6 -4ERX 3.0 PTH_PSEAE
30 PsiBlast_CBE 86.2534% -92 - C6 -4QBK 6.7 PTH_PSEAE
34 PsiBlast_CBE 85.3534% -93 - C6 -4ERX 2.2 PTH_PSEAE
37 PsiBlast_CBE 85.1634% -96 - C6 -4DJJ 2.9 PTH_PSEAE
28 PsiBlast_CBE 84.3640% -98 - C6 -3NEA 3.0 PTH_FRATT