@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA4748: (2016-03-01 )
MRRPLVAGNWKMHGTHSSVAELIKGLRQLALPSGVDVAVMPPCLFISQVIQGLAGKAIDVGAQNSAVEPMQGALTGETAPSQLADVGCSMVLVGHSERRLILGESDEVVSRKFAAAQSCGLVPVLCVGETRAEREAGKTLEVVARQLGSVIDELGVGAFARAVVAYEPVWAIGTGLTASPAQAQEVHAAIRAQLAAENAEVAKGVRLLYGGSVKAASAAELFGMPDIDGGLVGGASLNADEFGAICRAAGS

Atome Classification :

(67 SA) -.........10........20......-.--.30-.-.......40........50..-.--...--..60........70........80........90........100.......110.........120.......130.......140.......150.......160.......170.......180.......190....-.-.--.200........210.......220.......230.......240.......250---
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -MRRPLVAGNWKMHGTHSSVAELIKGLR-Q--LAL-P-SGVDVAVMPPCLFISQVIQGL-A--GKA--IDVGAQNSAVEPMQGALTGETAPSQLADVGCSMVLVGHSERRLILGESDEVVS--RKFAAAQSCGLVPVLCVGETRAEREAGKTLEVVARQLGSVIDELGVGAFARAVVAYEPVWAIGTGLTASPAQAQEVHAAIRAQLAA-E-N--AE-VAKGVRLLYGGSVKAASAAELFGMPDIDGGLVGGASLNADEFGAICRAAGS----
21 PsiBlast_CBE 94.3952%-113 - C5 -4MVA ? B:[25-273] -MRHPLVMGNWKLNGSRHMVHELVSNLRKE--LAG-V-AGCAVAIAPPEMYIDMAKREA-E--GSH--IMLGAQNVDLN-LSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIA--KKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAK-V-D--AN-IAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAA------
1 PsiBlast_PDB 93.9652%-110 - C5 -4K6A ? A:[25-273] -MRHPLVMGNWKLNGSRHMVHELVSNLRKE--LAG-V-AGCAVAIAPPEMYIDMAKREA-E--GSH--IMLGAQNVDLN-LSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIA--KKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAK-V-D--AN-IAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAA------
4 PsiBlast_PDB 93.3852%-108 - C5 -4IOT TPIS_ECODH A:[1-249] -MRHPLVMGNWKLNGSRHMVHELVSNLRKE--LAG-V-AGCAVAIAPPEMYIDMAKREA-E--GSH--IMLGAQNVDLN-LSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIA--KKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAK-V-D--AN-IAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAA------
2 PsiBlast_PDB 93.2452%-109 - C5 -4MVA ? A:[25-273] -MRHPLVMGNWKLNGSRHMVHELVSNLRKE--LAG-V-AGCAVAIAPPEMYIDMAKREA-E--GSH--IMLGAQNVDLN-LSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIA--KKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAK-V-D--AN-IAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAA------
8 PsiBlast_PDB 90.9249%-101 - C5 -4OHQ - TPIC_ARATH A:[6-251] ---KFFVGGNWKCNGTKDSIAKLISDLN-S--ATL-E-ADVDVVVSPPFVYIDQVKSSL-T--DR---IDISGQNSWV-GKGGAFTGEISVEQLKDLGCKWVILGHSERRHVIGEKDEFIG--KKAAYALSEGLGVIACIGEKLEEREAGKTFDVCFAQLKAFAD--AVPSWDNIVVAYEPVWAIGTGKVASPQQAQEVHVAVRGWLKK-NVS--EE-VASKTRIIYGGSVNGGNSAELAKEEDIDGFLVGGASLKGPEFATIVNSVTS----
3 PsiBlast_PDB 90.4952%-105 - C5 -1TRE - TPIS_ECOLI A:[3-251] -MRHPLVMGNWKLNGSRHMVHELVSNLRKE--LAG-V-AGCAVAIAPPEMYIDMAKREA-E--GSH--IMLGAQNVNLN-LSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIA--KKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAK-V-D--AN-IAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAA------
101 Fugue 89.9652%-102 - C5 -1TRE - TPIS_ECOLI A:[3-257] -MRHPLVMGNWKLNGSRHMVHELVSNLR-K--ELA-GVAGCAVAIAPPEMYIDMAKREAE---GSH--IMLGAQNVNLNL-SGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIA--KKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAK-V-D--AN-IAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQA
24 PsiBlast_CBE 88.8151%-105 - C5 -1TMH TPIS_ECOLI B:[1-248] -MRHPLVMGNWKLNGSRHMVHELVSNLRKE--LAG-V-AGCAVAIAPPEMYIDMAKREA-E--GSH--IMLGAQNVDLN-LSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIA--KKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAK-V-D--AN-IAEQVIIQYGGSVNASNAAELFAQHDVDGFLVGGASLKP-EFVDIINAA------
17 PsiBlast_PDB 88.7045%-107 - C5 -1R2T - TPIS_RABIT A:[4-246] --RKFFVGGNWKMNGRKKNLGELITTLN-A--AKV-P-ADTEVVCAPPTAYIDFARQKL-D--PK---IAVAAQN-CYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIG--QKVAHALSEGLGVIACIGEKLDEREAGITEKVVFEQTKVIAD--NVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKS-N-V--SDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKP-EFVDIINA-------
22 PsiBlast_CBE 88.6551%-103 - C5 -1TMH TPIS_ECOLI D:[1-248] -MRHPLVMGNWKLNGSRHMVHELVSNLRKE--LAG-V-AGCAVAIAPPEMYIDMAKREA-E--GSH--IMLGAQNVDLN-LSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIA--KKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAK-V-D--AN-IAEQVIIQYGGSVNASNAAELFAQHDVDGFLVGGASLKP-EFVDIINAA------
23 PsiBlast_CBE 88.6251%-105 - C5 -1TMH TPIS_ECOLI C:[1-248] -MRHPLVMGNWKLNGSRHMVHELVSNLRKE--LAG-V-AGCAVAIAPPEMYIDMAKREA-E--GSH--IMLGAQNVDLN-LSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIA--KKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAK-V-D--AN-IAEQVIIQYGGSVNASNAAELFAQHDVDGFLVGGASLKP-EFVDIINAA------
44 PsiBlast_CBE 88.4845%-109 - C5 -1R2R TPIS_RABIT D:[4-246] --RKFFVGGNWKMNGRKKNLGELITTLN-A--AKV-P-ADTEVVCAPPTAYIDFARQKL-D--PK---IAVAAQN-CYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIG--QKVAHALSEGLGVIACIGEKLDEREAGITEKVVFEQTKVIAD--NVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKS-N-V--SDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKP-EFVDIINA-------
14 PsiBlast_PDB 88.3844%-104 - C5 -4Y8F ? A:[4-248] -MRTPIIAGNWKMHYTIDEAVKLVEELK-P--LVK-D-AKCEVVVCPTFVCLDAVKKAV-E--GTN--IKVGAQNMHFEE-KGAFTGEIAPRMLEAMNIDYVIIGHSERREYFNETDETCN--KKVKAAFAHNLTPILCCGETLEQRENGTTNDVIKAQITADLEGLTKEQAEKVVIAYEPIWAIGTGKTATSDQANETIAAIRAMVAE-MFG--QE-VADKVRIQYGGSVKPNTIAEQMAKSDIDGALVGGASLVAADFAQI----------
113 HHSearch 88.3350%-102 - C5 -1AW2 TPIS_MORMI A:[2-252] --RHPVVMGNWKLNGSKEMVVDLLNGLN-A--ELEGV-TGVDVAVAPPALFVDLAERTL-TEAGSA--IILGAQNTD-LNNSGAFTGDMSPAMLKEFGATHIIIGHSERREYHAESDEFVA--KKFAFLKENGLTPVLCIGESDAQNEAGETMAVCARQLDAVINTQGVEALEGAIIAYEPIWAIGTGKAATAEDAQRIHAQIRAHIAE-K-S--EA-VAKNVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALDAKSFAAIAKAAA-----
37 PsiBlast_CBE 88.3350%-101 - C5 -4G1K ? B:[26-271] --RIKRVIGNWKMHGRLSGNQALLTEVA-QGAQAV-H-DNVAIGVCVPFPYLAQAQAQL-Q--GGR--VSWGSQDVSAHE-QGAYTGEVAAGMVAEFGAAYAIVGHSERRAYHGESNETVA--AKARRALAAGLTPIVCVGETLAEREAGTTEQVVGAQLDAVLAVLSPDEAARIVVAYEPVWAIGTGKSATAEQAQQVHAFLRGRLAA-K-G------AGHVSLLYGGSVKADNAAELFGQPDIDGGLIGGASLKSGDFLAICRAA------
35 PsiBlast_CBE 88.1150%-105 - C5 -4G1K ? D:[26-271] --RIKRVIGNWKMHGRLSGNQALLTEVA-QGAQAV-H-DNVAIGVCVPFPYLAQAQAQL-Q--GGR--VSWGSQDVSAHE-QGAYTGEVAAGMVAEFGAAYAIVGHSERRAYHGESNETVA--AKARRALAAGLTPIVCVGETLAEREAGTTEQVVGAQLDAVLAVLSPDEAARIVVAYEPVWA------ATAEQAQQVHAFLRGRLAA-K-G------AGHVSLLYGGSVKADNAAELFGQPDIDGGLIGGASLKSGDFLAICRAA------
36 PsiBlast_CBE 87.9250%-101 - C5 -4G1K ? C:[26-271] --RIKRVIGNWKMHGRLSGNQALLTEVA-QGAQAV-H-DNVAIGVCVPFPYLAQAQAQL-Q--GGR--VSWGSQDVSAHE-QGAYTGEVAAGMVAEFGAAYAIVGHSERRAYHGESNETVA--AKARRALAAGLTPIVCVGETLAEREAGTTEQVVGAQLDAVLAVLSPDEAARIVVAYEPVWAIGTGKSATAEQAQQVHAFLRGRLAA-K-G------AGHVSLLYGGSVKADNAAELFGQPDIDGGLIGGASLKSGDFLAICRAA------
5 PsiBlast_PDB 87.9051%-106 - C5 -1TMH TPIS_ECOLI A:[1-248] -MRHPLVMGNWKLNGSRHMVHELVSNLRKE--LAG-V-AGCAVAIAPPEMYIDMAKREA-E--GSH--IMLGAQNVDLN-LSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIA--KKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAK-V-D--AN-IAEQVIIQYGGSVNASNAAELFAQHDVDGFLVGGASLKP-EFVDIINAA------
45 PsiBlast_CBE 87.6845%-106 - C5 -1R2R TPIS_RABIT C:[4-246] --RKFFVGGNWKMNGRKKNLGELITTLN-A--AKV-P-ADTEVVCAPPTAYIDFARQKL-D--PK---IAVAAQN-CYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIG--QKVAHALSEGLGVIACIGEKLDEREAGITEKVVFEQTKVIAD--NVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKS-N-V--SDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKP-EFVDIINA-------
9 PsiBlast_PDB 87.5750%-102 - C5 -4G1K ? A:[26-271] --RIKRVIGNWKMHGRLSGNQALLTEVA-QGAQAV-H-DNVAIGVCVPFPYLAQAQAQL-Q--GGR--VSWGSQDVSAHE-QGAYTGEVAAGMVAEFGAAYAIVGHSERRAYHGESNETVA--AKARRALAAGLTPIVCVGETLAEREAGTTEQVVGAQLDAVLAVLSPDEAARIVVAYEPVWAIGTGKSATAEQAQQVHAFLRGRLAA-K-G------AGHVSLLYGGSVKADNAAELFGQPDIDGGLIGGASLKSGDFLAICRAA------
84 PsiBlast_CBE 87.0742%-108 - C5 -2Y62 TPIS_LEIME A:[6-249] ---QPIAAANWKCNGTTASIEKLVQVFN-E--HTI-S-HDVQCVVAPTFVHIPLVQAKL-R--NPK--YVISAQNAIAK--SGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVA--QKVSEACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIAAKLTKDAWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLR-KWVS-E-NIGTD-VAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKP-EFRDIIDA-------
68 PsiBlast_CBE 86.6944%-106 - C5 -4HHP ? A:[6-249] ---QPIAAANWKCNGSESLLVPLIETLN-A--ATF-D-HDVQCVVAPTFLHIPMTKARL-T--NPK--FQIAAQNAITR--SGAFTGEVSLQILKDYGISWVVLGHSERRLYYGDTNEIVA--EKVAQACAAGFHVIVCVGETNEEREAGRTAAVVLTQLAAVAQKLSKEAWSRVVIAYEPVWAIGTGKVATPQQAQEVHELLRRWVRS-KLG--TD-IAAQLRILYGGSVTAKNARTLYQMRDINGFLVGGASLK-PEFVEIIEA-------
10 PsiBlast_PDB 86.5345%-101 - C5 -4MKN ? A:[20-265] ---KFFVGGNWKCNGSVANVAKLVDELN-A--GTI-P-RGVDVVVAPPFIYIDYVMQHL-D--RDK--YQLSAQNAWIGG-NGAFTGEVSAEQLTDFGVPWVILGHSERRSLFGESNEVVA--KKTSHALAAGLGVIACIGETLEQRNSGSVFKVLDAQMDALVDE--VKDWTKVVLAYEPVWAIGTGVVASPEQAQEVHAYLRQYCAK-KLG--AA-VADKLRIIYGGSVSDTNCKDLSKQEDIDGFLVGGASLKGAAFVTICNAAG-----
83 PsiBlast_CBE 86.4642%-106 - C5 -2Y63 TPIS_LEIME A:[6-249] ---QPIAAANWKCNGTTASIEKLVQVFN-E--HTI-S-HDVQCVVAPTFVHIPLVQAKL-R--NPK--YVISAQNAIAK--SGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVA--QKVSEACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIAAKLTKDAWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLR-KWVS-E-NIGTD-VAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKP-EFRDIIDA-------
102 Fugue 86.3041%-103 - C5 -1IF2 TPIS_LEIME A:[3-251] AKPQPIAAANWKCNGTTASIEKLVQVFN-E--HTI-S-HDVQCVVAPTFVHIPLVQAKL-R--NPK--YVISAQN--AIAKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVA--QKVSEACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIAAKLTKDAWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLRKWVSE-NIG--TD-VAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKPE-FRDIIDATR-----
88 PsiBlast_CBE 86.2242%-107 - C5 -1N55 TPIS_LEIME A:[6-249] ---QPIAAANWKCNGTTASIEKLVQVFN-E--HTI-S-HDVQCVVAPTFVHIPLVQAKL-R--NPK--YVISAQNAIAK--SGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVA--QKVSEACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIAAKLTKDAWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLR-KWVS-E-NIGTD-VAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKP-EFRDIIDA-------
85 PsiBlast_CBE 85.9042%-106 - C5 -2Y61 TPIS_LEIME A:[6-249] ---QPIAAANWKCNGTTASIEKLVQVFN-E--HTI-S-HDVQCVVAPTFVHIPLVQAKL-R--NPK--YVISAQNAIAK--SGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVA--QKVSEACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIAAKLTKDAWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLR-KWVS-E-NIGTD-VAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKP-EFRDIIDA-------
18 PsiBlast_PDB 85.5445%-103 - C5 -4OWG TPIS_RABIT A:[4-246] --RKFFVGGNWKMNGRKKNLGELITTLN-A--AKV-P-ADTEVVCAPPTAYIDFARQKL-D--PK---IAVAAQN-CYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIG--QKVAHALSEGLGVIACIGEKLDEREAGITEKVVFEQTKVIAD--NVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKS-N-V--SDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKP-EFVDIINA-------
86 PsiBlast_CBE 85.4742%-105 - C5 -2VXN TPIS_LEIME A:[6-249] ---QPIAAANWKCNGTTASIEKLVQVFN-E--HTI-S-HDVQCVVAPTFVHIPLVQAKL-R--NPK--YVISAQNAIAK--SGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVA--QKVSEACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIAAKLTKDAWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLR-KWVS-E-NIGTD-VAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKP-EFRDIIDA-------
80 PsiBlast_CBE 85.4143%-104 - C5 -1SW7 TPIS_CHICK A:[4-246] --RKFFVGGNWKMNGDKKSLGELIHTLN-G--AKL-S-ADTEVVCGAPSIYLDFARQKL-D--AK---IGVAAQNCYKVP-KGAFTGEISPAMIKDIGAAWVILGHSERRHVFGESDELIG--QKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKAIADN--VKDWSKVVLAYEPVWAIGTGNSSTPQQAQEVHEKLRGWLKS-H-V--SDAVAQSTRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKP-EFVDIINA-------
87 PsiBlast_CBE 85.3742%-104 - C5 -1QDS TPIS_LEIME A:[6-249] ---QPIAAANWKCNGTTASIEKLVQVFN-E--HTI-S-HDVQCVVAPTFVHIPLVQAKL-R--NPK--YVISAQNAIAK--SGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVA--QKVSEACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIAAKLTKDAWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLR-KWVS-E-NIGTD-VAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKP-EFRDIIDA-------
116 HHSearch 85.3039%-106 - C5 -2J27 TPIS_TRYBB A:[3-249] -KPQPIAAANWKCNGSQQSLSELIDLFN-S--TSI-N-HDVQCVVASTFVHLAMTKERL-S--HPK--FVIAAQNAI-A-KSGAFTGEVSLPILKDFGVNWIVLGHSERRAYYGETNEIVA--DKVAAAVASGFMVIACIGETLQERESGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEAVWAIGTGKVATPQQAQEAHALIRSWVSS-K-I--GADVAGELRILYGGSVNGKNARTLYQQRDVNGFLVGGASLKPE-FVDIIKAT------
120 HHSearch 85.0842%-102 - C5 -2VXN TPIS_LEIME A:[4-250] -KPQPIAAANWKCNGTTASIEKLVQVFN-E--HTI-S-HDVQCVVAPTFVHIPLVQAKL-R--NPK--YVISAQNAI-A-KSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVA--QKVSEACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIAAKLTKDAWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLRKWVSE-N-I--GTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKPE-FRDIIDAT------
95 PsiBlast_CBE 84.6140%-104 - C5 -3UWW TPIS_STAAR A:[9-253] -MRTPIIAGNWKMNKTVQEAKDFVNALP-T--LPD-S-KEVESVICAPAIQLDALTTAV-KE-GKAQGLEIGAQNTYFED-NGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEIN--KKAHAIFKHGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADLS-S--KE-VSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDF-------------
79 PsiBlast_CBE 84.5743%-101 - C5 -1SW7 TPIS_CHICK B:[4-246] --RKFFVGGNWKMNGDKKSLGELIHTLN-G--AKL-S-ADTEVVCGAPSIYLDFARQKL-D--AK---IGVAAQNCYKVP-KGAFTGEISPAMIKDIGAAWVILGHSERRHVFGESDELIG--QKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKAIADN--VKDWSKVVLAYEPVWAIGTGNSSTPQQAQEVHEKLRGWLKS-H-V--SDAVAQSTRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKP-EFVDIINA-------
64 PsiBlast_CBE 84.4244%-102 - C5 -1SW0 TPIS_CHICK A:[4-246] --RKFFVGGNWKMNGDKKSLGELIHTLN-G--AKL-S-ADTEVVCGAPSIYLDFARQKL-D--AK---IGVAAQNCYKVP-KGAFTGEISPAMIKDIGAAWVILGHSERRHVFGESDELIG--QKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKAIADN--VKDWSKVVLAYEPVWAIGTGLWATPQQAQEVHEKLRGWLKS-H-V--SDAVAQSTRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKP-EFVDIINA-------
89 PsiBlast_CBE 84.4042%-102 - C5 -1IF2 TPIS_LEIME A:[6-249] ---QPIAAANWKCNGTTASIEKLVQVFN-E--HTI-S-HDVQCVVAPTFVHIPLVQAKL-R--NPK--YVISAQNAIAK--SGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVA--QKVSEACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIAAKLTKDAWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLR-KWVS-E-NIGTD-VAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKP-EFRDIIDA-------
72 PsiBlast_CBE 84.3244%-103 - C5 -1SW3 TPIS_CHICK A:[4-246] --RKFFVGGNWKMNGDKKSLGELIHTLN-G--AKL-S-ADTEVVCGAPSIYLDFARQKL-D--AK---IGVAAQNCYKVP-KGAFTGEISPAMIKDIGAAWVILGHSERRHVFGESDELIG--QKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKAIADN--VKDWSKVVLAYEPVWAIGTGKVATPQQAQEVHEKLRGWLKS-H-V--SDAVAQSTRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKP-EFVDIINA-------
99 PsiBlast_CBE 84.2540