@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_1368: (2015-12-23 )
MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKNPMFSLDERLKMMQLATKSFKNVECVAFEGLLADLAKEYHCKVLVRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEIYPFISKV

Atome Classification :

(47 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

COD_A_2(3PXU)
COAD_BURP1
[Raw transfer]




COA_B_11(3OTW)
COAD_HELPY
[Raw transfer]




COA_A_8(3OTW)
COAD_HELPY
[Raw transfer]




COA_F_19(3OTW)
COAD_HELPY
[Raw transfer]




COD_J_10(1B6T)
COAD_ECOLI
[Raw transfer]




COA_E_18(3OTW)
COAD_HELPY
[Raw transfer]




COA_D_15(3OTW)
COAD_HELPY
[Raw transfer]




COA_C_13(3OTW)
COAD_HELPY
[Raw transfer]




COA_A_2(3L92)
COAD_YERPE
[Raw transfer]




ATP_B_6(1GN8)
COAD_ECOLI
[Raw transfer]




ATP_A_4(1GN8)
COAD_ECOLI
[Raw transfer]




AGS_B_6(4NAU)
COAD_STAAW
[Raw transfer]




4PS_A_2(3K9W)
COAD_BURP1
[Raw transfer]




4PS_A_2(3K9W)
COAD_BURP1
[Raw transfer]




AGS_C_7(4NAU)
COAD_STAAW
[Raw transfer]




AGS_F_16(4NAH)
COAD_STAAW
[Raw transfer]




AGS_D_13(4NAH)
COAD_STAAW
[Raw transfer]




ADP_A_5(1O6B)
COAD_BACSU
[Raw transfer]




AGS_A_4(4NAU)
COAD_STAAW
[Raw transfer]




PPS_A_2(3F3M)
COAD_STAAW
[Raw transfer]




ADP_A_5(1O6B)
COAD_BACSU
[Raw transfer]




AGS_E_15(4NAH)
COAD_STAAW
[Raw transfer]




COA_A_7(1H1T)
COAD_ECOLI
[Raw transfer]




PNS_D_10(1VLH)
COAD_THEMA
[Raw transfer]




PNS_B_8(1VLH)
COAD_THEMA
[Raw transfer]




ADP_C_11(4NAT)
COAD_STAAW
[Raw transfer]




PNS_A_7(1VLH)
COAD_THEMA
[Raw transfer]




PNS_A_7(1VLH)
COAD_THEMA
[Raw transfer]




PNS_C_9(1VLH)
COAD_THEMA
[Raw transfer]




PNS_B_22(1QJC)
COAD_ECOLI
[Raw transfer]




PNS_B_8(1H1T)
COAD_ECOLI
[Raw transfer]




PNS_F_12(1VLH)
COAD_THEMA
[Raw transfer]




PNS_E_11(1VLH)
COAD_THEMA
[Raw transfer]




ADP_B_9(4NAT)
COAD_STAAW
[Raw transfer]




ADP_A_6(4NAT)
COAD_STAAW
[Raw transfer]




PNS_A_2(1OD6)
COAD_THET8
[Raw transfer]




PNS_A_5(3NBK)
COAD_MYCTU
[Raw transfer]




2VJ_A_9(4NAH)
COAD_STAAW
[Raw transfer]




2VJ_A_8(4NAH)
COAD_STAAW
[Raw transfer]




2VJ_B_11(4NAH)
COAD_STAAW
[Raw transfer]




ACY_A_6(3NV7)
COAD_HELPY
[Raw transfer]




ACY_A_6(3NV7)
COAD_HELPY
[Raw transfer]




25 PsiBlast_CBE 96.7798%-147 - C2 -3OTW 9.2 COAD_HELPY
22 PsiBlast_CBE 96.0698%-142 - C2 -3OTW 9.2 COAD_HELPY
23 PsiBlast_CBE 95.3998%-147 - C2 -3OTW 9.0 COAD_HELPY
1 PsiBlast_PDB 94.9598%-148 - C2 -3OTW 9.7 COAD_HELPY
21 PsiBlast_CBE 94.4698%-143 - C2 -3OTW 8.5 COAD_HELPY
24 PsiBlast_CBE 94.2798%-141 - C2 -3OTW 8.6 COAD_HELPY
114 HHSearch 83.4297%-161 - C2 -3NV7 3.5 COAD_HELPY
2 PsiBlast_PDB 83.3597%-161 - C2 -3NV7 3.5 COAD_HELPY
100 Fugue 79.0746%-132 - C2 -1B6T - COAD_ECOLI -
101 Fugue 77.4845%-140 - C2 -1B6T - COAD_ECOLI -
5 PsiBlast_PDB 77.4649%-125 - C2 -1H1T 5.4 COAD_ECOLI
112 HHSearch 77.4547%-129 - C2 -1QJC - COAD_ECOLI -
115 HHSearch 76.4844%-135 - C2 -3K9W 5.1 COAD_BURP1
3 PsiBlast_PDB 76.1749%-129 - C2 -1B6T - COAD_ECOLI -
6 PsiBlast_PDB 74.9748%-126 - C2 -1QJC - COAD_ECOLI -
27 PsiBlast_CBE 74.9549%-128 - C2 -1GN8 7.4 COAD_ECOLI
111 HHSearch 74.9044%-137 * C2 *1OD6 3.6 COAD_THET8
29 PsiBlast_CBE 74.8048%-129 - C2 -1QJC 4.4 COAD_ECOLI
10 PsiBlast_PDB 74.0645%-145 - C2 -3PXU 9.9 COAD_BURP1
9 PsiBlast_PDB 73.9745%-142 - C2 -3K9W 5.1 COAD_BURP1
11 PsiBlast_PDB 73.9645%-140 - C2 -3F3M 5.8 COAD_STAAW
28 PsiBlast_CBE 73.9249%-126 - C2 -1B6T 9.4 COAD_ECOLI
26 PsiBlast_CBE 73.8849%-131 - C2 -1H1T 3.5 COAD_ECOLI
4 PsiBlast_PDB 73.5349%-122 - C2 -1GN8 6.4 COAD_ECOLI
116 HHSearch 73.5041%-135 - C2 -1O6B 6.7 COAD_BACSU
43 PsiBlast_CBE 73.3543%-140 - C2 -1VLH 4.6 COAD_THEMA
113 HHSearch 72.8842%-139 - C2 -1VLH 4.9 COAD_THEMA
39 PsiBlast_CBE 72.6643%-141 - C2 -1VLH 4.2 COAD_THEMA
40 PsiBlast_CBE 72.0843%-138 - C2 -1VLH 5.2 COAD_THEMA
38 PsiBlast_CBE 71.6945%-134 - C2 -4NAH 7.5 COAD_STAAW
37 PsiBlast_CBE 71.6245%-135 - C2 -4NAH 7.5 COAD_STAAW
36 PsiBlast_CBE 71.5245%-136 - C2 -4NAH 5.4 COAD_STAAW
117 HHSearch 71.4834%-126 - C2 -3NBK 3.3 COAD_MYCTU
32 PsiBlast_CBE 71.3545%-141 - C2 -4NAT 4.2 COAD_STAAW
42 PsiBlast_CBE 71.3443%-141 - C2 -1VLH 4.6 COAD_THEMA
16 PsiBlast_PDB 71.2943%-137 - C2 -1VLH 4.9 COAD_THEMA
41 PsiBlast_CBE 71.1943%-143 - C2 -1VLH 5.1 COAD_THEMA
7 PsiBlast_PDB 71.1447%-129 - C2 -3L92 7.3 COAD_YERPE
31 PsiBlast_CBE 71.0745%-134 - C2 -4NAU 7.4 COAD_STAAW
34 PsiBlast_CBE 71.0345%-136 - C2 -4NAH 6.8 COAD_STAAW
17 PsiBlast_PDB 70.8542%-136 - C2 -1O6B 6.7 COAD_BACSU
13 PsiBlast_PDB 70.4045%-138 - C2 -4NAT 4.3 COAD_STAAW
33 PsiBlast_CBE 70.3745%-132 - C2 -4NAT 3.5 COAD_STAAW
12 PsiBlast_PDB 70.2545%-141 - C2 -4NAH 8.4 COAD_STAAW
35 PsiBlast_CBE 70.0345%-131 - C2 -4NAH 6.8 COAD_STAAW
14 PsiBlast_PDB 69.0945%-137 - C2 -4NAU 6.7 COAD_STAAW
30 PsiBlast_CBE 67.9845%-136 - C2 -4NAU 7.0 COAD_STAAW