@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1691: (2016-03-27 )
LKVRGFEVVNEASRKFPEQTISLPIRGDKGSAGYDFFSNETVTIVPGEKHIFWTDIKSYMQEDEVLNIYVRSSIGIKKGLLLCNGTGIIDSSYYSNPGNDGNIGIAIKNFSNEPVSIEAGERVAQGVFQKYLVADTDIVANESRVGGVGSTGR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_B_7(3F4F)
DUT_YEAST
[Raw transfer]




UMP_B_6(3F4F)
DUT_YEAST
[Raw transfer]




DU3_C_9(3T64)
?
[Raw transfer]




62 HHSearch 85.8237% -96 - C4 -3ZF6 - ? -
56 HHSearch 84.5829% -82 - C4 -3HZA - DUT_MYCTU -
63 HHSearch 80.0130% -95 - C4 -3LQW - ? -
14 PsiBlast_PDB 79.1333%-103 - C4 -3TQZ - DUT_COXBU -
52 HHSearch 78.4229% -84 * C4 *1SJN - DUT_MYCTU -
9 PsiBlast_PDB 77.7829%-100 - C4 -1EU5 - DUT_ECOLI -
10 PsiBlast_PDB 77.7629%-100 - C4 -1DUD - DUT_ECOLI -
53 HHSearch 77.5929% -94 - C4 -3MDX - DUT_BRUA2 -
11 PsiBlast_PDB 77.4629%-103 - C4 -2HR6 - DUT_ECOLI -
38 PsiBlast_CBE 76.4531% -94 - C4 -3LQW - ? -
3 PsiBlast_PDB 76.2330% -87 - C4 -3EHW - DUT_HUMAN -
68 HHSearch 75.0233% -81 - C4 -3TQZ - DUT_COXBU -
2 PsiBlast_PDB 74.9030% -88 - C4 -2HQU - DUT_HUMAN -
13 PsiBlast_PDB 74.8529%-106 - C4 -1SYL - DUT_ECOLI -
67 HHSearch 74.5129%-123 - C4 -1F7D - POL_FIVPE -
12 PsiBlast_PDB 74.4029% -98 - C4 -2HRM - DUT_ECOLI -
8 PsiBlast_PDB 74.2529% -98 - C4 -1DUP - DUT_ECOLI -
59 HHSearch 73.0227% -92 - C4 -3F4F 3.2 DUT_YEAST
19 PsiBlast_PDB 71.8329%-102 - C4 -1SMC - DUT_MYCTU -
27 PsiBlast_CBE 71.5432%-111 - C4 -2OKE - ? -