@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2181: (2016-04-01 )
VKIKSFLGKSLTLVVLGVFLFSGWKIGMELYENKHNQTILDDAKAVYTKDAATTNVNGEVRDELRDLQKLNKDMVGWLTIIDTEIDYPILQSKDNDYYLHHNYKNEKARAGSIFKDYRNTNEFLDKNTIIYGHNMKDGSMFADLRKYLDKDFLVAHPTFSYESGLTNYEVEIFAVYETTTDFYYIETEFPETTDFEDYLQKVKQQSVYTSNVKVSGKDRIITLSTCDTEKDYEKGRMVIQGKLVTK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

E64_A_2(1QX6)
?
[Raw transfer]




EDO_B_19(3PSQ)
?
[Raw transfer]




ETM_A_3(1QXA)
?
[Raw transfer]




ETM_A_7(1QWZ)
?
[Raw transfer]




ETM_A_7(1QWZ)
?
[Raw transfer]




ACY_A_8(3PSQ)
?
[Raw transfer]




CHAIN_G_6(4LFD)
?
[Raw transfer]

-

1 PsiBlast_PDB 96.0046% -70 - C3 -1RZ2 - ? -
21 PsiBlast_CBE 86.2739% -79 - C3 -4LFD 3.1 ?
7 PsiBlast_PDB 86.2438% -75 - C3 -1QX6 2.9 ?
41 Fugue 85.8335% -61 - C3 -1NG5 - ? -
5 PsiBlast_PDB 85.8239% -81 - C3 -4LFD - ? -
22 PsiBlast_CBE 85.7639% -80 - C3 -4LFD - ? -
6 PsiBlast_PDB 85.6838% -74 - C3 -1NG5 - ? -
4 PsiBlast_PDB 85.5739% -76 - C3 -1QXA 1.8 ?
3 PsiBlast_PDB 85.4739% -74 - C3 -1QWZ 2.5 ?
25 HHSearch 85.3935% -62 - C3 -1QWZ 2.5 ?
20 PsiBlast_CBE 85.3939% -78 - C3 -4LFD - ? -
23 PsiBlast_CBE 81.3436% -62 - C3 -4UX7 - ? -
24 PsiBlast_CBE 80.9733% -84 - C3 -3PSQ 2.0 ?
8 PsiBlast_PDB 80.6336% -62 - C3 -4UX7 - ? -
26 HHSearch 79.8131% -68 - C3 -3PSQ - ? -
10 PsiBlast_PDB 78.5633% -74 - C3 -3PSQ 3.8 ?
9 PsiBlast_PDB 76.3136% -67 - C3 -4Y4Q - ? -
30 HHSearch 64.4426% -57 - C3 -2KW8 - ? -
2 PsiBlast_PDB 63.4746% 64 - C3 -2OQW - ? -
32 HHSearch 57.7317% -71 - C3 -3FN5 - ? -