@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF01471_MMP7_H: (2014-09-24 )
YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK

Atome Classification :

(15 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

RRS_A_6(1MMQ)
MMP7_HUMAN
[Raw transfer]




RSS_B_12(1MMP)
MMP7_HUMAN
[Raw transfer]




BAT_A_6(1RM8)
MMP16_HUMAN
[Raw transfer]




MM3_A_13(1D5J)
MMP3_HUMAN
[Raw transfer]




0XX_A_9(4H1Q)
MMP9_HUMAN
[Raw transfer]




SPC_A_13(1D7X)
MMP3_HUMAN
[Raw transfer]




BSI_A_6(1I76)
MMP8_HUMAN
[Raw transfer]




FA4_A_13(2D1O)
MMP3_HUMAN
[Raw transfer]




SRS_A_6(1MMR)
MMP7_HUMAN
[Raw transfer]




TQI_A_7(2Y6C)
MMP7_HUMAN
[Raw transfer]




GOL_A_11(4IN9)
?
[Raw transfer]




HAE_A_8(3BA0)
MMP12_HUMAN
[Raw transfer]




CPS_A_25(1HV5)
MMP11_MOUSE
[Raw transfer]




PGO_A_18(4FVL)
?
[Raw transfer]




CHAIN_B_2(4IN9)
?
[Raw transfer]

-

0XX_B_15(4H1Q)
MMP9_HUMAN
[Raw transfer]




CHAIN_B_2(3AYU)
MMP2_HUMAN
[Raw transfer]

-

CHAIN_C_3(4FVL)
?
[Raw transfer]

-

3 PsiBlast_PDB 97.17100% -98 - C1 -1MMR 7.1 MMP7_HUMAN
2 PsiBlast_PDB 96.95100%-104 - C1 -1MMQ 7.2 MMP7_HUMAN
21 PsiBlast_CBE 95.89100% -98 - C1 -1MMP 6.4 MMP7_HUMAN
4 PsiBlast_PDB 94.43100%-108 - C1 -2Y6C 6.0 MMP7_HUMAN
20 PsiBlast_PDB 83.0454%-102 - C1 -2D1O 7.4 MMP3_HUMAN
13 PsiBlast_PDB 82.4454%-100 - C1 -1D5J 5.1 MMP3_HUMAN
11 PsiBlast_PDB 80.0154% -91 - C1 -1D7X 4.2 MMP3_HUMAN
47 HHSearch 79.0947% -97 - C1 -1RM8 6.2 MMP16_HUMAN
35 HHSearch 78.3249%-102 - C1 -4FVL 10.7 ?
43 HHSearch 77.5453% -96 * C1 *3AYU 9.9 MMP2_HUMAN
44 HHSearch 75.3550% -93 - C1 -1I76 7.0 MMP8_HUMAN
36 HHSearch 74.7456% -93 - C1 -3BA0 3.5 MMP12_HUMAN
50 HHSearch 71.2147% -92 - C1 -1HV5 3.1 MMP11_MOUSE
42 HHSearch 71.0945% -94 - C1 -4H1Q 7.1 MMP9_HUMAN
49 HHSearch 69.2037% -94 - C1 -4IN9 5.8 ?