@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1237: (2016-03-22 )
VKQAIGFIDSGVGGLTVVREVLKQLPHEQVYYLGDTARCPYGPRDKEEVAKFTWEMTNFLVDRGIKMLVIACNTATAAALYDIREKLDIPVIGVIQPGSRAALKATRNNKIGVLGTLGTVESMAYPTALKGLNRRVEVDSLACPKFVSVVESGEYKSAIAKKVVAESLLPLKSTKIDTVILGCTHYPLLKPIIENFMGDGVAVINSGEETASEVSALLDYHNLLDATDEEIEHRFFTTGSTQIFKDIAKDWLNMPDMTVEHIKLGK

Atome Classification :

(50 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DGL_B_5(2JFP)
MURI_ENTFA
[Raw transfer]




DGL_A_3(2JFP)
MURI_ENTFA
[Raw transfer]




DGL_H_8(1ZUW)
MURI1_BACSU
[Raw transfer]




GLU_A_3(2JFO)
MURI_ENTFA
[Raw transfer]




DGL_A_4(3OUT)
?
[Raw transfer]




DGL_A_4(3OUT)
?
[Raw transfer]




DGL_A_9(2DWU)
?
[Raw transfer]




DGL_B_8(2DWU)
?
[Raw transfer]




DGL_C_7(2DWU)
?
[Raw transfer]




DGL_A_9(2DWU)
?
[Raw transfer]




SIN_A_3(3IST)
MURI_LISMO
[Raw transfer]




DGL_A_3(3UHF)
MURI_CAMJE
[Raw transfer]




SIN_A_3(3IST)
MURI_LISMO
[Raw transfer]




DGL_B_8(3UHO)
MURI_CAMJE
[Raw transfer]




DGL_A_3(2JFY)
MURI_HELPJ
[Raw transfer]




DGL_B_4(2JFY)
MURI_HELPJ
[Raw transfer]




DGL_B_8(3UHF)
MURI_CAMJE
[Raw transfer]




DGL_B_6(2W4I)
MURI_HELPJ
[Raw transfer]




DGL_E_5(1ZUW)
MURI1_BACSU
[Raw transfer]




DGL_B_4(2JFQ)
MURI_STAAR
[Raw transfer]




DGL_A_4(2VVT)
MURI_ENTFA
[Raw transfer]




DGL_B_6(2VVT)
MURI_ENTFA
[Raw transfer]




DGL_A_3(3UHF)
MURI_CAMJE
[Raw transfer]




DGL_A_3(2JFQ)
MURI_STAAR
[Raw transfer]




DGL_E_5(1ZUW)
MURI1_BACSU
[Raw transfer]




DGL_A_4(2JFZ)
MURI_HELPJ
[Raw transfer]




DGL_A_5(2W4I)
MURI_HELPJ
[Raw transfer]




DGL_A_4(2JFZ)
MURI_HELPJ
[Raw transfer]




DGL_F_10(2W4I)
MURI_HELPJ
[Raw transfer]




DGL_B_4(2JFO)
MURI_ENTFA
[Raw transfer]




DGL_F_6(1ZUW)
MURI1_BACSU
[Raw transfer]




DGL_B_5(4B1F)
MURI_HELPJ
[Raw transfer]




DGL_A_3(3UHO)
MURI_CAMJE
[Raw transfer]




DGL_A_4(4B1F)
MURI_HELPJ
[Raw transfer]




DGL_E_8(2W4I)
MURI_HELPJ
[Raw transfer]




GLU_A_2(2JFN)
MURI_ECOLI
[Raw transfer]




FLC_A_3(2JFV)
?
[Raw transfer]




DGN_C_3(1B74)
MURI_AQUPY
[Raw transfer]




NHL_A_2(2OHV)
MURI_STRP1
[Raw transfer]




DGN_C_3(1B74)
MURI_AQUPY
[Raw transfer]




DGN_C_3(1B74)
MURI_AQUPY
[Raw transfer]




DGN_C_3(1B74)
MURI_AQUPY
[Raw transfer]




3 PsiBlast_PDB 97.5497%-135 - C3 -3ISV - MURI_LISMO -
52 HHSearch 96.03100%-133 - C3 -3IST 3.9 MURI_LISMO
1 PsiBlast_PDB 95.8997%-136 - C3 -3HFR - MURI_LISMO -
2 PsiBlast_PDB 95.3797%-133 - C3 -3IST 3.9 MURI_LISMO
9 PsiBlast_PDB 84.3258%-128 - C3 -2JFP 4.4 MURI_ENTFA
7 PsiBlast_PDB 83.1758%-127 - C3 -2VVT 4.5 MURI_ENTFA
69 Fugue 83.0961%-125 * C3 *2JFV 4.8 ?
22 PsiBlast_CBE 83.0058%-125 - C3 -2JFP 4.3 MURI_ENTFA
8 PsiBlast_PDB 82.9258%-124 - C3 -2JFO 4.6 MURI_ENTFA
14 PsiBlast_PDB 82.5852%-138 - C3 -2OHO - MURI_STRP1 -
21 PsiBlast_CBE 82.5158%-124 - C3 -2VVT 4.5 MURI_ENTFA
4 PsiBlast_PDB 82.4562%-124 - C3 -2JFU - ? -
23 PsiBlast_CBE 81.7558%-124 - C3 -2JFO 4.0 MURI_ENTFA
29 PsiBlast_CBE 81.1052%-132 - C3 -2OHO - MURI_STRP1 -
12 PsiBlast_PDB 80.3852%-131 - C3 -2OHG - MURI_STRP1 -
30 PsiBlast_CBE 80.2450%-123 - C3 -2JFQ 4.5 MURI_STAAR
13 PsiBlast_PDB 79.9152%-132 - C3 -2OHV 3.7 MURI_STRP1
26 PsiBlast_CBE 79.7357%-122 - C3 -2GZM - ? -
15 PsiBlast_PDB 79.5850%-124 - C3 -2JFQ 4.5 MURI_STAAR
10 PsiBlast_PDB 78.9557%-119 - C3 -2GZM - ? -
11 PsiBlast_PDB 78.6754%-121 - C3 -1ZUW 4.5 MURI1_BACSU
51 HHSearch 77.7555%-121 - C3 -1ZUW 4.5 MURI1_BACSU
28 PsiBlast_CBE 76.7354%-124 - C3 -1ZUW 4.2 MURI1_BACSU
27 PsiBlast_CBE 76.4854%-122 - C3 -1ZUW 4.7 MURI1_BACSU
31 PsiBlast_CBE 75.4551%-121 - C3 -2DWU 4.6 ?
16 PsiBlast_PDB 75.3451%-122 - C3 -2DWU 4.6 ?
32 PsiBlast_CBE 74.5651%-121 - C3 -2DWU 4.5 ?
50 HHSearch 74.3250%-114 - C3 -2DWU 4.6 ?
57 HHSearch 67.8333%-112 - C3 -2JFZ 4.3 MURI_HELPJ
33 PsiBlast_CBE 66.2734%-109 - C3 -3UHO 4.3 MURI_CAMJE
35 PsiBlast_CBE 65.7734%-114 - C3 -3UHF 4.7 MURI_CAMJE
36 PsiBlast_CBE 65.1332%-108 - C3 -4B1F 4.4 MURI_HELPJ
20 PsiBlast_PDB 64.7634%-113 - C3 -3UHF 4.6 MURI_CAMJE
19 PsiBlast_PDB 64.4634%-118 - C3 -3OUT 4.3 ?
55 HHSearch 64.2635%-117 - C3 -3OUT 4.3 ?
40 PsiBlast_CBE 64.2332%-100 - C3 -2W4I 4.4 MURI_HELPJ
34 PsiBlast_CBE 64.0534%-113 - C3 -3UHO 4.5 MURI_CAMJE
37 PsiBlast_CBE 63.9732%-107 - C3 -4B1F 4.4 MURI_HELPJ
39 PsiBlast_CBE 63.8932%-101 - C3 -2W4I 4.5 MURI_HELPJ
38 PsiBlast_CBE 63.5432%-102 - C3 -2W4I 4.6 MURI_HELPJ
43 PsiBlast_CBE 63.5032%-107 - C3 -2JFZ 4.3 MURI_HELPJ
44 PsiBlast_CBE 62.9532%-102 - C3 -2JFY 4.7 MURI_HELPJ
56 HHSearch 62.2735%-105 - C3 -3UHF 4.6 MURI_CAMJE
41 PsiBlast_CBE 62.2632%-100 - C3 -2W4I 4.7 MURI_HELPJ
45 PsiBlast_CBE 61.0632%-101 - C3 -2JFY 4.7 MURI_HELPJ
18 PsiBlast_PDB 60.6643%-112 - C3 -1B74 2.4 MURI_AQUPY
70 Fugue 60.4740%-113 - C3 -1B74 2.4 MURI_AQUPY
71 Fugue 58.3339%-109 - C3 -1B74 2.4 MURI_AQUPY
48 PsiBlast_CBE 52.6331% -98 - C3 -2JFN 8.4 MURI_ECOLI
74 Fugue 29.9044%-104 - C3 -1B74 2.5 MURI_AQUPY