@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1705: (2016-03-27 )
MEGVENKVIVLAGMIGAGKSSYTELIANELGTKAFYESIKDNRILEMFYDDPKRWAFALQIYFLNTRFRSIKAALTDQNNVLDRSIYEDALFTQINFEEGNISEPEMDTYLDLLDNMMEELAYMPKKAPDLLIYLRGSLDTVLSRIALRGRPYEQIDDNPGLLEYYKHLHSRYDSWFASYDKSETLVINIDEIDINKPNDADYVMQLIHEKLKR

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DCP_A_3(2JAQ)
?
[Raw transfer]




DCP_A_3(2JAQ)
?
[Raw transfer]




DTP_A_7(2JAS)
?
[Raw transfer]




DTP_C_12(2JAS)
?
[Raw transfer]




DTP_E_15(2JAS)
?
[Raw transfer]




DTP_B_10(2JAS)
?
[Raw transfer]




DTP_D_13(2JAS)
?
[Raw transfer]




DTP_F_17(2JAS)
?
[Raw transfer]




DCM_B_8(2JAT)
?
[Raw transfer]




DCM_A_5(2JAT)
?
[Raw transfer]




ADP_A_3(2ZI9)
DCK_HUMAN
[Raw transfer]




UDP_D_18(2A2Z)
DCK_HUMAN
[Raw transfer]




UDP_B_14(2A2Z)
DCK_HUMAN
[Raw transfer]




ADP_A_3(2ZI3)
DCK_HUMAN
[Raw transfer]




UDP_C_16(2A2Z)
DCK_HUMAN
[Raw transfer]




UDP_A_12(2A2Z)
DCK_HUMAN
[Raw transfer]




36 HHSearch 94.0531% -99 - C2 -2JAQ 8.3 ?
35 HHSearch 89.3529% -96 - C2 -1P5Z - DCK_HUMAN -
4 PsiBlast_PDB 88.2231% -97 - C2 -2A2Z 5.6 DCK_HUMAN
31 PsiBlast_CBE 87.8731% -94 - C2 -2A2Z 5.2 DCK_HUMAN
9 PsiBlast_PDB 87.5929%-102 - C2 -3QEN - DCK_HUMAN -
34 HHSearch 87.5524% -92 * C2 *2OCP - DGUOK_HUMAN -
7 PsiBlast_PDB 87.0029% -97 - C2 -2ZI9 6.1 DCK_HUMAN
28 PsiBlast_CBE 86.9831%-100 - C2 -2A30 - DCK_HUMAN -
6 PsiBlast_PDB 86.4729% -96 - C2 -2ZI3 7.0 DCK_HUMAN
32 PsiBlast_CBE 86.3531% -96 - C2 -2A2Z 5.5 DCK_HUMAN
14 PsiBlast_PDB 86.1429% -96 - C2 -4JLN - DCK_HUMAN -
27 PsiBlast_CBE 85.7431% -99 - C2 -2A30 - DCK_HUMAN -
30 PsiBlast_CBE 85.2731% -96 - C2 -2A2Z 5.5 DCK_HUMAN
8 PsiBlast_PDB 85.2229% -96 - C2 -3QEJ - DCK_HUMAN -
17 PsiBlast_PDB 85.1229% -99 - C2 -4Q19 - DCK_HUMAN -
5 PsiBlast_PDB 84.9731%-100 - C2 -2A30 - DCK_HUMAN -
18 PsiBlast_PDB 84.9229%-101 - C2 -4Q1C - DCK_HUMAN -
20 PsiBlast_PDB 84.8929%-100 - C2 -4Q1F - DCK_HUMAN -
15 PsiBlast_PDB 83.8329% -97 - C2 -4KCG - DCK_HUMAN -
16 PsiBlast_PDB 83.7829% -96 - C2 -4Q18 - DCK_HUMAN -
21 PsiBlast_CBE 80.5133% -86 - C2 -2JAT 4.5 ?
2 PsiBlast_PDB 80.3033% -87 - C2 -2JAT 4.4 ?
1 PsiBlast_PDB 79.6533% -92 - C2 -2JAQ 8.3 ?
23 PsiBlast_CBE 76.0633% -83 - C2 -2JAS 8.6 ?
3 PsiBlast_PDB 74.6933% -75 - C2 -2JAS 6.8 ?
26 PsiBlast_CBE 73.8433% -79 - C2 -2JAS 7.0 ?
24 PsiBlast_CBE 73.6033% -80 - C2 -2JAS 6.5 ?
25 PsiBlast_CBE 73.5033% -75 - C2 -2JAS 8.6 ?
22 PsiBlast_CBE 73.1633% -83 - C2 -2JAS 7.2 ?