@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF01712_DCK_MO: (2014-09-27 )
MATPPKRFCPSPSTSSEGTRIKKISIEGNIAAGKSTFVNILKQASEDWEVVPEPVARWCNVQSTQEEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNSQFGQSLELDGIIYLRATPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTSFDYLQEVPVLTLDVNEDFKDKHESLVEKVKEFLSTL

Atome Classification :

(62 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

D5M_B_13(2QRO)
DCK_HUMAN
[Raw transfer]




D5M_A_10(2QRO)
DCK_HUMAN
[Raw transfer]




DCM_B_12(2QRN)
DCK_HUMAN
[Raw transfer]




DCM_C_14(2QRN)
DCK_HUMAN
[Raw transfer]




DCP_A_5(2VP4)
DNK_DROME
[Raw transfer]




D5M_C_15(2QRO)
DCK_HUMAN
[Raw transfer]




DCM_A_10(2QRN)
DCK_HUMAN
[Raw transfer]




DCM_D_16(2QRN)
DCK_HUMAN
[Raw transfer]




D5M_D_16(2QRO)
DCK_HUMAN
[Raw transfer]




3L1_A_3(2ZI4)
DCK_HUMAN
[Raw transfer]




LDC_A_5(2NO7)
DCK_HUMAN
[Raw transfer]




LDC_B_6(2NO7)
DCK_HUMAN
[Raw transfer]




DCZ_C_9(2A30)
DCK_HUMAN
[Raw transfer]




AR3_B_3(1P5Z)
DCK_HUMAN
[Raw transfer]




DCZ_E_5(1P61)
DCK_HUMAN
[Raw transfer]




LTT_B_6(2NO9)
DCK_HUMAN
[Raw transfer]




DCZ_B_6(2NO1)
DCK_HUMAN
[Raw transfer]




3D1_A_4(2ZI3)
DCK_HUMAN
[Raw transfer]




DCZ_A_4(1P60)
DCK_HUMAN
[Raw transfer]




3TC_B_6(2NOA)
DCK_HUMAN
[Raw transfer]




DCZ_A_5(2NO1)
DCK_HUMAN
[Raw transfer]




CFB_A_4(2A7Q)
DCK_HUMAN
[Raw transfer]




LTT_A_4(2NO9)
DCK_HUMAN
[Raw transfer]




3TC_A_4(2NOA)
DCK_HUMAN
[Raw transfer]




CL9_A_4(2ZI9)
DCK_HUMAN
[Raw transfer]




MCY_B_6(3KFX)
DCK_HUMAN
[Raw transfer]




MCY_A_4(3KFX)
DCK_HUMAN
[Raw transfer]




GNG_A_5(2ZI7)
DCK_HUMAN
[Raw transfer]




GEO_B_6(2NO0)
DCK_HUMAN
[Raw transfer]




CL9_B_6(2ZI9)
DCK_HUMAN
[Raw transfer]




GEO_A_4(2NO0)
DCK_HUMAN
[Raw transfer]




LLT_A_3(3HP1)
DCK_HUMAN
[Raw transfer]




B86_A_3(3IPX)
DCK_HUMAN
[Raw transfer]




DCZ_D_10(2A30)
DCK_HUMAN
[Raw transfer]




GEO_B_4(1P62)
DCK_HUMAN
[Raw transfer]




ETV_A_4(2NO6)
DCK_HUMAN
[Raw transfer]




3L1_A_6(2ZI5)
DCK_HUMAN
[Raw transfer]




3L1_B_8(2ZI5)
DCK_HUMAN
[Raw transfer]




ETV_B_6(2NO6)
DCK_HUMAN
[Raw transfer]




3D1_C_8(2ZI6)
DCK_HUMAN
[Raw transfer]




3L1_C_10(2ZI5)
DCK_HUMAN
[Raw transfer]




1UX_A_3(4L5B)
DCK_HUMAN
[Raw transfer]




5BT_A_4(3QEN)
DCK_HUMAN
[Raw transfer]




DCZ_E_5(1J90)
DNK_DROME
[Raw transfer]




18V_B_5(4JLN)
?
[Raw transfer]




18V_A_3(4JLN)
?
[Raw transfer]




1UX_B_5(4L5B)
DCK_HUMAN
[Raw transfer]




1NN_B_6(4JLM)
?
[Raw transfer]




1NO_B_7(4JLK)
DCK_HUMAN
[Raw transfer]




ADP_A_3(2ZI9)
DCK_HUMAN
[Raw transfer]




5BT_B_6(3QEN)
DCK_HUMAN
[Raw transfer]




1NO_A_4(4JLK)
DCK_HUMAN
[Raw transfer]




ADP_A_3(2NO1)
DCK_HUMAN
[Raw transfer]




ADP_A_3(2NO9)
DCK_HUMAN
[Raw transfer]




UDP_A_6(2ZI7)
DCK_HUMAN
[Raw transfer]




ADP_B_5(2NO9)
DCK_HUMAN
[Raw transfer]




1NM_B_6(4JLJ)
?
[Raw transfer]




ADP_A_3(2NO6)
DCK_HUMAN
[Raw transfer]




1NM_A_3(4JLJ)
?
[Raw transfer]




UDP_C_9(3MJR)
DCK_HUMAN
[Raw transfer]




ADP_B_5(2NO0)
DCK_HUMAN
[Raw transfer]




LLT_A_4(3QEO)
DCK_HUMAN
[Raw transfer]




ADP_A_3(2NO7)
DCK_HUMAN
[Raw transfer]




ADP_A_3(2ZI3)
DCK_HUMAN
[Raw transfer]




UDP_B_5(3QEO)
DCK_HUMAN
[Raw transfer]




ADP_A_3(2NOA)
DCK_HUMAN
[Raw transfer]




UDP_D_14(2QRO)
DCK_HUMAN
[Raw transfer]




ADP_B_5(2ZI9)
DCK_HUMAN
[Raw transfer]




ADP_B_4(2NO1)
DCK_HUMAN
[Raw transfer]




ADP_B_5(2NO6)
DCK_HUMAN
[Raw transfer]




ADP_A_3(3KFX)
DCK_HUMAN
[Raw transfer]




ADP_B_5(2NOA)
DCK_HUMAN
[Raw transfer]




ADP_A_3(2NO0)
DCK_HUMAN
[Raw transfer]




UDP_A_3(3QEN)
DCK_HUMAN
[Raw transfer]




ADP_B_5(3KFX)
DCK_HUMAN
[Raw transfer]




ADP_B_4(1P5Z)
DCK_HUMAN
[Raw transfer]




ADP_B_4(2NO7)
DCK_HUMAN
[Raw transfer]




UDP_B_8(4JLJ)
?
[Raw transfer]




UDP_C_9(2ZI5)
DCK_HUMAN
[Raw transfer]




UDP_B_7(2ZI5)
DCK_HUMAN
[Raw transfer]




UDP_C_12(2QRO)
DCK_HUMAN
[Raw transfer]




ADP_A_4(2ZI4)
DCK_HUMAN
[Raw transfer]




ADP_B_3(1P62)
DCK_HUMAN
[Raw transfer]




UDP_A_6(3MJR)
DCK_HUMAN
[Raw transfer]




UDP_B_4(3QEJ)
DCK_HUMAN
[Raw transfer]




ADP_A_2(3IPX)
DCK_HUMAN
[Raw transfer]




ADP_A_2(3HP1)
DCK_HUMAN
[Raw transfer]




UDP_A_5(4JLM)
?
[Raw transfer]




UDP_A_5(2ZI5)
DCK_HUMAN
[Raw transfer]




UDP_A_3(4JLK)
DCK_HUMAN
[Raw transfer]




UDP_A_3(3QEO)
DCK_HUMAN
[Raw transfer]




UDP_B_6(4JLN)
?
[Raw transfer]




UDP_A_4(4JLN)
?
[Raw transfer]




UDP_B_6(4L5B)
DCK_HUMAN
[Raw transfer]




UDP_A_5(4JLJ)
?
[Raw transfer]




UDP_B_11(2QRO)
DCK_HUMAN
[Raw transfer]




ADP_A_3(1P60)
DCK_HUMAN
[Raw transfer]




ADP_C_3(1P61)
DCK_HUMAN
[Raw transfer]




UDP_A_4(4L5B)
DCK_HUMAN
[Raw transfer]




AC2_A_5(3MJR)
DCK_HUMAN
[Raw transfer]




UDP_B_7(4JLM)
?
[Raw transfer]




ADP_A_3(2A7Q)
DCK_HUMAN
[Raw transfer]




UDP_A_9(2QRO)
DCK_HUMAN
[Raw transfer]




UDP_B_5(3QEN)
DCK_HUMAN
[Raw transfer]




UDP_A_3(3QEJ)
DCK_HUMAN
[Raw transfer]




UDP_B_11(2QRN)
DCK_HUMAN
[Raw transfer]




1NN_A_3(4JLM)
?
[Raw transfer]




UDP_B_6(4JLK)
DCK_HUMAN
[Raw transfer]




UDP_A_9(2QRN)
DCK_HUMAN
[Raw transfer]




UDP_D_15(2QRN)
DCK_HUMAN
[Raw transfer]




B87_A_4(3IPY)
DCK_HUMAN
[Raw transfer]




B87_B_7(3IPY)
DCK_HUMAN
[Raw transfer]




LLT_B_6(3QEO)
DCK_HUMAN
[Raw transfer]




UDP_C_13(2QRN)
DCK_HUMAN
[Raw transfer]




UDP_A_5(2ZI6)
DCK_HUMAN
[Raw transfer]




1NO_A_5(4JLK)
DCK_HUMAN
[Raw transfer]




1NM_A_4(4JLJ)
?
[Raw transfer]




17 PsiBlast_PDB 95.9292% -96 - C1 -2NO7 8.5 DCK_HUMAN
53 PsiBlast_CBE 95.4792% -96 - C1 -2ZI3 7.7 DCK_HUMAN
28 PsiBlast_CBE 95.0992% -94 - C1 -3KFX 8.5 DCK_HUMAN
15 PsiBlast_PDB 94.9292% -96 - C1 -2NO1 8.7 DCK_HUMAN
13 PsiBlast_PDB 94.8492% -93 - C1 -2NOA 8.8 DCK_HUMAN
57 PsiBlast_CBE 94.7494%-106 - C1 -3IPY 7.1 DCK_HUMAN
12 PsiBlast_PDB 94.6492% -94 - C1 -2NO9 8.8 DCK_HUMAN
58 PsiBlast_CBE 94.6094% -99 - C1 -3IPX 7.3 DCK_HUMAN
52 PsiBlast_CBE 94.5792% -97 - C1 -2ZI9 7.0 DCK_HUMAN
2 PsiBlast_PDB 94.5593% -91 - C1 -1P60 8.9 DCK_HUMAN
4 PsiBlast_PDB 94.4993%-102 - C1 -1P62 7.7 DCK_HUMAN
1 PsiBlast_PDB 94.3193%-100 - C1 -1P5Z 7.6 DCK_HUMAN
36 PsiBlast_CBE 94.2392%-103 - C1 -2NO6 8.9 DCK_HUMAN
16 PsiBlast_PDB 94.2092% -94 - C1 -2NO6 8.9 DCK_HUMAN
37 PsiBlast_CBE 94.0192%-104 - C1 -2NO1 9.2 DCK_HUMAN
56 PsiBlast_CBE 93.8794%-106 - C1 -3IPY 7.0 DCK_HUMAN
35 PsiBlast_CBE 93.7892%-107 - C1 -2NO7 9.4 DCK_HUMAN
39 PsiBlast_CBE 93.7192%-104 - C1 -4L5B 8.4 DCK_HUMAN
38 PsiBlast_CBE 93.6992%-103 - C1 -2NO0 9.3 DCK_HUMAN
24 PsiBlast_CBE 93.4193%-106 - C1 -2QRN 5.2 DCK_HUMAN
14 PsiBlast_PDB 93.3592% -89 - C1 -2NO0 8.7 DCK_HUMAN
11 PsiBlast_PDB 93.2892%-101 - C1 -3KFX 9.7 DCK_HUMAN
6 PsiBlast_PDB 93.1393%-105 - C1 -2QRN 5.8 DCK_HUMAN
26 PsiBlast_CBE 93.0893%-105 - C1 -2QRN 5.2 DCK_HUMAN
41 PsiBlast_CBE 92.9692% -99 - C1 -4JLN 8.6 ?
25 PsiBlast_CBE 92.8893%-106 - C1 -2QRN 5.4 DCK_HUMAN
8 PsiBlast_PDB 92.7892% -99 - C1 -2ZI4 7.3 DCK_HUMAN
5 PsiBlast_PDB 92.7093%-100 - C1 -2A7Q 6.4 DCK_HUMAN
29 PsiBlast_CBE 92.6392%-104 - C1 -2ZI7 8.0 DCK_HUMAN
34 PsiBlast_CBE 92.5792% -98 - C1 -2NO9 9.3 DCK_HUMAN
3 PsiBlast_PDB 92.4293% -95 - C1 -1P61 7.1 DCK_HUMAN
42 PsiBlast_CBE 92.2892% -97 - C1 -4JLM 6.8 ?
18 PsiBlast_PDB 92.2792%-100 - C1 -3HP1 7.3 DCK_HUMAN
40 PsiBlast_CBE 92.1792% -97 - C1 -4JLN 8.2 ?
20 PsiBlast_PDB 92.1792%-101 - C1 -4L5B 8.4 DCK_HUMAN
19 PsiBlast_PDB 92.0692% -99 - C1 -4JLK 7.6 DCK_HUMAN
21 PsiBlast_CBE 91.9093%-102 - C1 -2QRO 5.3 DCK_HUMAN
46 PsiBlast_CBE 91.8892% -97 - C1 -4JLJ 8.1 ?
51 PsiBlast_CBE 91.7892% -99 - C1 -2ZI9 7.9 DCK_HUMAN
49 PsiBlast_CBE 91.6492% -96 - C1 -3QEJ 7.1 DCK_HUMAN
33 PsiBlast_CBE 91.5592% -99 - C1 -2NOA 9.2 DCK_HUMAN
22 PsiBlast_CBE 91.4593%-103 - C1 -2QRO 5.0 DCK_HUMAN
45 PsiBlast_CBE 91.4392% -99 - C1 -4JLJ 7.2 ?
32 PsiBlast_CBE 91.2592%-104 - C1 -2ZI5 6.6 DCK_HUMAN
47 PsiBlast_CBE 91.1592% -98 - C1 -3QEN 7.2 DCK_HUMAN
27 PsiBlast_CBE 91.1092%-106 - C1 -3MJR 5.3 DCK_HUMAN
54 PsiBlast_CBE 91.0091%-102 - C1 -3QEO 6.3 DCK_HUMAN
23 PsiBlast_CBE 90.9493%-101 - C1 -2QRO 5.4 DCK_HUMAN
30 PsiBlast_CBE 90.8992%-109 - C1 -2ZI6 5.0 DCK_HUMAN
50 PsiBlast_CBE 90.8092% -94 - C1 -3QEJ 7.4 DCK_HUMAN
55 PsiBlast_CBE 90.7391% -95 - C1 -3QEO 7.2 DCK_HUMAN
7 PsiBlast_PDB 90.4893%-102 - C1 -2QRO 5.4 DCK_HUMAN
44 PsiBlast_CBE 90.4792% -96 - C1 -4JLK 6.7 DCK_HUMAN
43 PsiBlast_CBE 90.3992% -94 - C1 -4JLM 7.1 ?
48 PsiBlast_CBE 90.2892% -96 - C1 -3QEN 6.6 DCK_HUMAN
31 PsiBlast_CBE 89.8692%-102 - C1 -2ZI5 6.6 DCK_HUMAN
9 PsiBlast_PDB 89.7892%-101 - C1 -2ZI5 5.9 DCK_HUMAN
60 PsiBlast_CBE 89.7188%-110 * C1 *2A30 4.3 DCK_HUMAN
10 PsiBlast_PDB 88.4792% -93 - C1 -3MJR 6.7 DCK_HUMAN
59 PsiBlast_CBE 86.8888%-108 - C1 -2A30 5.0 DCK_HUMAN
73 HHSearch 55.0033% -86 - C1 -2VP4 9.8 DNK_DROME
62 Fugue 52.9334% -71 - C1 -1J90 4.6 DNK_DROME