@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1517: (2016-03-25 )
MSGLTKIEIITRPNRFHLFQKELAKIGVSGLTVTKALGTGLEKGFIELYRGTKKESNIHERMKIEIVVSTVPVEDVLRVVKETLRTGEPGDGKVFIYPLAEVVKISTGETGIDALQDKPSK

Atome Classification :

(30 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_C_8(1UL3)
GLNB_SYNY3
[Raw transfer]




ATP_A_5(4USI)
?
[Raw transfer]




ATP_B_8(4USI)
?
[Raw transfer]




ADP_F_11(4C3K)
GLNB_SYNE7
[Raw transfer]




ATP_B_10(2XUL)
GLNB_SYNE7
[Raw transfer]




ADP_D_9(4C3K)
GLNB_SYNE7
[Raw transfer]




ATP_D_16(2XUL)
GLNB_SYNE7
[Raw transfer]




ADP_A_3(3N5B)
?
[Raw transfer]




AKG_H_26(2XZW)
GLNB_SYNE7
[Raw transfer]




FLC_A_4(4AFF)
GLNB_SYNE7
[Raw transfer]




AKG_F_22(2XZW)
GLNB_SYNE7
[Raw transfer]




AKG_E_20(2XUL)
GLNB_SYNE7
[Raw transfer]




TLA_A_2(4CO5)
?
[Raw transfer]




FLC_E_5(2O66)
GLNB_ARATH
[Raw transfer]




FLC_D_4(2O66)
GLNB_ARATH
[Raw transfer]




FLC_D_4(2O66)
GLNB_ARATH
[Raw transfer]




FLC_F_6(2O66)
GLNB_ARATH
[Raw transfer]




1 PsiBlast_PDB 93.7852%-128 - C8 -4R25 - NRGB_BACSU -
21 PsiBlast_CBE 84.3145%-101 - C8 -4USJ - ? -
4 PsiBlast_PDB 83.7945%-101 - C8 -4USJ - ? -
12 PsiBlast_PDB 82.8537%-126 - C8 -4AFF 2.4 GLNB_SYNE7
53 PsiBlast_CBE 82.7037%-105 - C8 -2XZW - GLNB_SYNE7 -
17 PsiBlast_PDB 82.3537%-108 - C8 -2XUL - GLNB_SYNE7 -
67 PsiBlast_CBE 81.8839%-104 - C8 -2RD5 - GLNB_ARATH -
117 HHSearch 81.7538%-130 - C8 -2O66 2.0 GLNB_ARATH
55 PsiBlast_CBE 81.7437%-110 - C8 -2XUL 3.5 GLNB_SYNE7
68 PsiBlast_CBE 81.6639%-100 - C8 -2RD5 - GLNB_ARATH -
24 PsiBlast_CBE 81.5845%-135 - C8 -4USH - ? -
44 PsiBlast_CBE 81.5137%-132 - C8 -4C3K 4.3 GLNB_SYNE7
52 PsiBlast_CBE 81.3737%-121 - C8 -2XZW - GLNB_SYNE7 -
30 PsiBlast_CBE 81.2638%-120 - C8 -2J9D - Y059_METJA -
13 PsiBlast_PDB 81.1937%-101 - C8 -2XBP - GLNB_SYNE7 -
3 PsiBlast_PDB 81.0745%-109 - C8 -4USI 5.0 ?
50 PsiBlast_CBE 81.0237%-114 - C8 -2XZW 2.9 GLNB_SYNE7
57 PsiBlast_CBE 81.0037%-113 - C8 -2XUL 5.3 GLNB_SYNE7
120 HHSearch 80.7539%-111 - C8 -3NCQ - ? -
80 PsiBlast_CBE 80.7539%-111 - C8 -3NCQ - ? -
74 PsiBlast_CBE 80.0439%-134 - C8 -2O66 2.0 GLNB_ARATH
83 PsiBlast_CBE 79.7637%-100 - C8 -3N5B 4.8 ?
56 PsiBlast_CBE 79.7237%-113 - C8 -2XUL 6.1 GLNB_SYNE7
23 PsiBlast_CBE 79.5745%-121 - C8 -4USI 6.1 ?
73 PsiBlast_CBE 79.2739%-136 - C8 -2O66 2.1 GLNB_ARATH
48 PsiBlast_CBE 78.8637%-101 - C8 -2XZW 3.3 GLNB_SYNE7
42 PsiBlast_CBE 78.7137%-116 - C8 -4C3K 5.2 GLNB_SYNE7
72 PsiBlast_CBE 78.3339%-136 - C8 -2O66 3.8 GLNB_ARATH
94 PsiBlast_CBE 77.2139%-134 - C8 -1UL3 Error GLNB_SYNY3
97 PsiBlast_CBE 72.2335% -99 - C8 -4CO5 3.3 ?