@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA3361: (2016-02-16 )
MATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG

Atome Classification :

(91 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SUGAR_C_7(1OVS)
?
[Raw transfer]

-

FUC_A_8(2VUD)
?
[Raw transfer]




MMA_B_8(2JDY)
?
[Raw transfer]




YX0_C_13(2VUC)
?
[Raw transfer]




YX0_B_9(2VUC)
?
[Raw transfer]




SUGAR_B_6(1OVS)
?
[Raw transfer]

-

MMA_C_12(2JDN)
?
[Raw transfer]




BDF_A_2(1OVP)
?
[Raw transfer]




MAN_A_2(1OUR)
?
[Raw transfer]




MMA_D_14(2JDY)
?
[Raw transfer]




MMA_A_5(2JDY)
?
[Raw transfer]




GXL_A_5(2BP6)
?
[Raw transfer]




FUC_B_10(1OXC)
?
[Raw transfer]




FUL_D_16(1OXC)
?
[Raw transfer]




GXL_C_13(2BP6)
?
[Raw transfer]




MMA_D_16(2JDN)
?
[Raw transfer]




SUGAR_A_5(2CHH)
?
[Raw transfer]

-

FUC_A_5(2VUC)
?
[Raw transfer]




FUC_B_12(4CE8)
?
[Raw transfer]




MFU_C_13(2JDU)
?
[Raw transfer]




GXL_D_16(2BP6)
?
[Raw transfer]




FUC_A_5(2JDH)
?
[Raw transfer]




SUGAR_A_5(2CHH)
?
[Raw transfer]

-

GXL_B_9(2BP6)
?
[Raw transfer]




SUGAR_A_5(1OVS)
?
[Raw transfer]

-

MMA_B_9(2JDN)
?
[Raw transfer]




FUC_A_8(1UZV)
?
[Raw transfer]




MFU_C_15(2JDM)
?
[Raw transfer]




MMA_C_11(2JDY)
?
[Raw transfer]




MFU_C_11(2JDP)
?
[Raw transfer]




FUC_C_17(4CE8)
?
[Raw transfer]




FUL_A_5(1OXC)
?
[Raw transfer]




ARW_C_11(2BOJ)
?
[Raw transfer]




FUC_D_22(4CE8)
?
[Raw transfer]




MFU_A_5(2JDP)
?
[Raw transfer]




SUGAR_A_7(1W8H)
?
[Raw transfer]

-

2G0_C_15(3DCQ)
?
[Raw transfer]




MFU_D_18(2JDU)
?
[Raw transfer]




LZ0_D_16(2VUD)
?
[Raw transfer]




FUC_C_15(1UZV)
?
[Raw transfer]




MMA_A_5(2BV4)
?
[Raw transfer]




FUC_C_13(1OXC)
?
[Raw transfer]




MFU_B_8(2JDP)
?
[Raw transfer]




FUC_A_8(2JDN)
?
[Raw transfer]




FUC_B_12(1UZV)
?
[Raw transfer]




FUC_A_5(2JDK)
?
[Raw transfer]




MFU_B_11(2JDM)
?
[Raw transfer]




MFU_D_14(2JDP)
?
[Raw transfer]




FUC_D_18(1UZV)
?
[Raw transfer]




LZ0_B_9(2VUD)
?
[Raw transfer]




MFU_D_18(2JDM)
?
[Raw transfer]




ARW_A_5(2BOJ)
?
[Raw transfer]




SUGAR_B_8(2JDH)
?
[Raw transfer]

-

ARW_B_8(2BOJ)
?
[Raw transfer]




SUGAR_B_8(2JDK)
?
[Raw transfer]

-

MMA_B_12(5A3O)
?
[Raw transfer]




SUGAR_D_17(2JDH)
?
[Raw transfer]

-

ARW_D_15(2BOJ)
?
[Raw transfer]




SUGAR_C_15(2JDH)
?
[Raw transfer]

-

SUGAR_D_17(2JDK)
?
[Raw transfer]

-

SUGAR_C_15(2JDK)
?
[Raw transfer]

-

MMA_A_7(5A3O)
?
[Raw transfer]




MMA_A_5(2BV4)
?
[Raw transfer]




MMA_B_8(2BV4)
?
[Raw transfer]




MMA_D_22(5A3O)
?
[Raw transfer]




MMA_C_17(5A3O)
?
[Raw transfer]




SUGAR_D_20(1W8H)
?
[Raw transfer]

-

MMA_A_4(1UQX)
?
[Raw transfer]




MFU_B_8(2BOI)
?
[Raw transfer]




2G0_A_13(3DCQ)
?
[Raw transfer]




2G0_B_14(3DCQ)
?
[Raw transfer]




SUGAR_C_16(1W8H)
?
[Raw transfer]

-

SUGAR_B_13(1W8H)
?
[Raw transfer]

-

2G0_D_16(3DCQ)
?
[Raw transfer]




YX0_D_16(2VUC)
?
[Raw transfer]




SUGAR_C_13(4UT5)
?
[Raw transfer]

-

SUGAR_D_16(4UT5)
?
[Raw transfer]

-

LZ0_C_13(2VUD)
?
[Raw transfer]




SUGAR_A_7(4UT5)
?
[Raw transfer]

-

SUGAR_A_2(2WRA)
?
[Raw transfer]

-

SUGAR_B_10(4UT5)
?
[Raw transfer]

-

SUGAR_C_17(1W8F)
?
[Raw transfer]

-

SUGAR_D_21(1W8F)
?
[Raw transfer]

-

SUGAR_B_12(1W8F)
?
[Raw transfer]

-

SUGAR_A_8(1W8F)
?
[Raw transfer]

-

F1A_C_18(3ZDV)
?
[Raw transfer]




F1A_D_22(3ZDV)
?
[Raw transfer]




F1A_B_12(3ZDV)
?
[Raw transfer]




F1A_A_8(3ZDV)
?
[Raw transfer]




60 PsiBlast_CBE 97.22100%-107 - C9 -4CE8 4.7 ?
91 PsiBlast_CBE 97.08100%-110 - C9 -1OUS - ? -
21 PsiBlast_CBE 97.00100%-107 - C9 -3ZDV 3.2 ?
28 PsiBlast_CBE 96.97100%-106 - C9 -2JDH 3.8 ?
75 PsiBlast_CBE 96.86100%-106 - C9 -2BP6 3.1 ?
77 PsiBlast_CBE 96.85100%-107 - C9 -2BOJ 3.1 ?
37 PsiBlast_CBE 96.80100%-107 - C9 -1GZT - ? -
79 PsiBlast_CBE 96.78100%-107 - C9 -1UZV 3.3 ?
19 PsiBlast_PDB 96.76100%-103 - C9 -2BOJ 3.0 ?
2 PsiBlast_PDB 96.73100%-107 - C9 -1W8F 3.6 ?
80 PsiBlast_CBE 96.65100%-106 - C9 -1UZV 3.4 ?
30 PsiBlast_CBE 96.56100%-106 - C9 -1W8H 4.2 ?
70 PsiBlast_CBE 96.55100%-106 - C9 -2VUC 3.3 ?
46 PsiBlast_CBE 96.5299%-107 - C9 -2JDM 3.5 ?
84 PsiBlast_CBE 96.46100%-106 - C9 -1OXC 5.1 ?
22 PsiBlast_CBE 96.41100%-108 - C9 -3ZDV 3.2 ?
74 PsiBlast_CBE 96.33100%-108 - C9 -2BP6 2.9 ?
32 PsiBlast_CBE 96.28100%-105 - C9 -1W8H 4.4 ?
86 PsiBlast_CBE 96.25100%-105 - C9 -1OVS 3.1 ?
43 PsiBlast_CBE 96.2599%-107 - C9 -2JDN 3.6 ?
24 PsiBlast_CBE 96.17100%-108 - C9 -2JDK 3.9 ?
34 PsiBlast_CBE 96.16100%-107 - C9 -1W8F 3.9 ?
57 PsiBlast_CBE 96.15100%-105 - C9 -5A3O 3.3 ?
33 PsiBlast_CBE 96.12100%-108 - C9 -1W8F 3.6 ?
73 PsiBlast_CBE 96.07100%-104 - C9 -2BP6 3.1 ?
64 PsiBlast_CBE 96.07100%-107 - C9 -3DCQ 3.9 ?
9 PsiBlast_PDB 96.0399%-105 - C9 -2JDP 3.3 ?
68 PsiBlast_CBE 95.98100%-108 - C9 -2VUD 3.4 ?
66 PsiBlast_CBE 95.95100%-108 - C9 -2VUD 2.8 ?
63 PsiBlast_CBE 95.94100%-102 - C9 -3DCQ 3.4 ?
6 PsiBlast_PDB 95.92100%-109 - C9 -3ZDV 2.9 ?
3 PsiBlast_PDB 95.91100%-101 - C9 -1W8H 5.1 ?
25 PsiBlast_CBE 95.88100%-105 - C9 -2JDK 3.9 ?
56 PsiBlast_CBE 95.86100%-105 - C9 -5A3O 3.3 ?
17 PsiBlast_PDB 95.77100%-104 - C9 -1OXC 4.8 ?
87 PsiBlast_CBE 95.76100%-102 * C9 *1OVS 3.3 ?
54 PsiBlast_CBE 95.73100%-108 - C9 -5A3O 3.4 ?
59 PsiBlast_CBE 95.67100%-106 - C9 -4CE8 4.7 ?
83 PsiBlast_CBE 95.61100%-108 - C9 -1OXC 4.9 ?
51 PsiBlast_CBE 95.6199%-108 - C9 -2JDU 3.5 ?
93 PsiBlast_CBE 95.6090%-101 - C9 -4UT5 3.3 ?
65 PsiBlast_CBE 95.53100%-105 - C9 -2VUD 2.8 ?
92 PsiBlast_CBE 95.4790%-104 - C9 -4UT5 3.3 ?
27 PsiBlast_CBE 95.42100%-102 - C9 -2JDH 3.9 ?
78 PsiBlast_CBE 95.41100%-104 - C9 -2BOJ 3.4 ?
31 PsiBlast_CBE 95.40100%-103 - C9 -1W8H 4.6 ?
18 PsiBlast_PDB 95.40100%-107 - C9 -1UZV 3.3 ?
16 PsiBlast_PDB 95.39100%-101 - C9 -1OVS 3.1 ?
52 PsiBlast_CBE 95.3899%-104 - C9 -2JDU 3.7 ?
69 PsiBlast_CBE 95.36100%-107 - C9 -2VUC 3.1 ?
39 PsiBlast_CBE 95.3699%-107 - C9 -2JDP 3.4 ?
23 PsiBlast_CBE 95.34100%-104 - C9 -3ZDV 3.2 ?
12 PsiBlast_PDB 95.31100%-108 - C9 -1OUR 3.1 ?
15 PsiBlast_PDB 95.30100%-106 - C9 -1OVP 4.5 ?
26 PsiBlast_CBE 95.26100%-106 - C9 -2JDK 3.9 ?
95 PsiBlast_CBE 95.2490%-103 - C9 -4UT5 3.2 ?
47 PsiBlast_CBE 95.2199%-103 - C9 -2JDM 3.4 ?
41 PsiBlast_CBE 95.2199%-101 - C9 -2JDP 3.7 ?
55 PsiBlast_CBE 95.20100%-108 - C9 -5A3O 3.3 ?
76 PsiBlast_CBE 95.17100%-105 - C9 -2BOJ 3.2 ?
58 PsiBlast_CBE 95.14100%-109 - C9 -4CE8 4.8 ?
20 PsiBlast_PDB 95.12100%-105 - C9 -2BP6 2.9 ?
67 PsiBlast_CBE 95.02100%-106 - C9 -2VUD 2.9 ?
11 PsiBlast_PDB 95.0199%-105 - C9 -2JDY 3.2 ?
42 PsiBlast_CBE 94.9899%-108 - C9 -2JDN 3.5 ?
81 PsiBlast_CBE 94.97100%-106 - C9 -1UZV 3.4 ?
29 PsiBlast_CBE 94.94100%-104 - C9 -2JDH 3.9 ?
62 PsiBlast_CBE 94.93100%-103 - C9 -3DCQ 3.2 ?
71 PsiBlast_CBE 94.92100%-105 - C9 -2VUC 3.5 ?
50 PsiBlast_CBE 94.8899%-103 - C9 -2JDY 3.4 ?
72 PsiBlast_CBE 94.83100%-105 - C9 -2VUC 3.3 ?
45 PsiBlast_CBE 94.8399%-108 - C9 -2JDM 3.4 ?
61 PsiBlast_CBE 94.70100%-103 - C9 -3DCQ 5.0 ?
4 PsiBlast_PDB 94.70100%-107 - C9 -2JDH 3.3 ?
40 PsiBlast_CBE 94.6699%-105 - C9 -2JDP 3.5 ?
94 PsiBlast_CBE 94.6590%-103 - C9 -4UT5 3.3 ?
35 PsiBlast_CBE 94.47100%-104 - C9 -1W8F 3.6 ?
5 PsiBlast_PDB 94.44100%-106 - C9 -2JDK 3.3 ?
48 PsiBlast_CBE 94.4399%-103 - C9 -2JDY 3.4 ?
82 PsiBlast_CBE 94.36100%-103 - C9 -1OXC 5.1 ?
8 PsiBlast_PDB 94.0999%-105 - C9 -2JDN 3.2 ?
44 PsiBlast_CBE 94.0799%-103 - C9 -2JDN 3.5 ?
49 PsiBlast_CBE 94.0699%-104 - C9 -2JDY 3.3 ?
111 HHSearch 87.9570%-100 - C9 -2CHH 5.6 ?
96 PsiBlast_CBE 87.7569%-100 - C9 -2CHH 5.6 ?
97 PsiBlast_CBE 87.2669%-100 - C9 -1UQX 3.6 ?
114 HHSearch 83.2061% -94 - C9 -2BV4 3.5 ?
99 PsiBlast_CBE 83.0060% -94 - C9 -2BV4 3.5 ?
100 PsiBlast_CBE 82.3860% -94 - C9 -2BOI 3.6 ?
98 PsiBlast_CBE 82.0460% -94 - C9 -2BV4 3.8 ?
113 HHSearch 76.6138%-100 - C9 -2WRA 3.3 ?