@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv0429c: (2016-04-22 )
MAVVPIRIVGDPVLHTATTPVTVAADGSLPADLAQLIATMYDTMDAANGVGLAANQIGCSLRLFVYDCAADRAMTARRRGVVINPVLETSEIPETMPDPDTDDEGCLSVPGESFPTGRAKWARVTGLDADGSPVSIEGTGLFARMLQHETGHLDGFLYLDRLIGRYARNAKRAVKSHGWGVPGLSWLPGEDPDPFGH

Atome Classification :

(90 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NVC_A_3(3E3U)
DEF_MYCTU
[Raw transfer]




NVC_A_3(3E3U)
DEF_MYCTU
[Raw transfer]




2BB_A_5(3K6L)
DEF_ECOLI
[Raw transfer]




BB1_B_8(1G27)
DEF_ECOLI
[Raw transfer]




BB1_C_9(1G27)
DEF_ECOLI
[Raw transfer]




BB1_A_7(1G27)
DEF_ECOLI
[Raw transfer]




2BB_B_7(3K6L)
DEF_ECOLI
[Raw transfer]




BB2_D_12(4WXL)
DEF_HAEI8
[Raw transfer]




BB2_C_11(1LRU)
DEF_ECOLI
[Raw transfer]




BB2_A_7(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_A_3(1LRY)
DEF_PSEAE
[Raw transfer]




BB2_A_7(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_A_7(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_A_5(3UWB)
?
[Raw transfer]




BB2_D_17(4DR9)
?
[Raw transfer]




BB2_C_10(4WXL)
DEF_HAEI8
[Raw transfer]




BB2_B_10(4DR9)
?
[Raw transfer]




BB2_A_5(3U04)
?
[Raw transfer]




BB2_B_10(1LRU)
DEF_ECOLI
[Raw transfer]




GNR_A_5(1S17)
DEF_PSEAE
[Raw transfer]




BB2_B_8(4WXL)
DEF_HAEI8
[Raw transfer]




BB2_C_14(4DR9)
?
[Raw transfer]




BB2_B_7(1IX1)
DEF_PSEAE
[Raw transfer]




GNR_B_6(1S17)
DEF_PSEAE
[Raw transfer]




BB2_B_8(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_A_6(4WXL)
DEF_HAEI8
[Raw transfer]




BB2_A_5(1IX1)
DEF_PSEAE
[Raw transfer]




BB2_C_9(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_A_9(1LRU)
DEF_ECOLI
[Raw transfer]




SB7_B_8(2AI8)
DEF_ECOLI
[Raw transfer]




GOL_C_10(4WXK)
DEF_HAEI8
[Raw transfer]




FMT_A_3(1XEO)
DEF_ECOLI
[Raw transfer]




SB7_A_7(2AI8)
DEF_ECOLI
[Raw transfer]




GOL_A_7(1N5N)
DEF_PSEAE
[Raw transfer]




EPE_B_6(1VEY)
DEF_LEPIN
[Raw transfer]




FMT_A_3(1XEO)
DEF_ECOLI
[Raw transfer]




FMT_A_3(1XEM)
DEF_ECOLI
[Raw transfer]




FMT_A_8(1VEV)
DEF_LEPIN
[Raw transfer]




FMT_A_13(1Y6H)
DEF_LEPIN
[Raw transfer]




GOL_A_7(1N5N)
DEF_PSEAE
[Raw transfer]




SB7_C_9(2AI8)
DEF_ECOLI
[Raw transfer]




FMT_A_13(1Y6H)
DEF_LEPIN
[Raw transfer]




GOL_A_6(4WXK)
DEF_HAEI8
[Raw transfer]




FMT_B_18(1VEZ)
DEF_LEPIN
[Raw transfer]




GOL_A_6(4WXK)
DEF_HAEI8
[Raw transfer]




MLN_A_4(1BSJ)
DEF_ECOLI
[Raw transfer]




FMT_B_11(4DR8)
?
[Raw transfer]




FMT_A_3(2W3U)
DEF_ECOLI
[Raw transfer]




EPE_A_5(1VEY)
DEF_LEPIN
[Raw transfer]




GOL_B_6(1N5N)
DEF_PSEAE
[Raw transfer]




MLN_A_4(1BSK)
DEF_ECOLI
[Raw transfer]




FMT_B_7(1Y6H)
DEF_LEPIN
[Raw transfer]




FMT_C_14(4DR8)
?
[Raw transfer]




GOL_D_12(4WXK)
DEF_HAEI8
[Raw transfer]




MES_B_6(1VEV)
DEF_LEPIN
[Raw transfer]




FMT_A_5(1XEN)
DEF_ECOLI
[Raw transfer]




GOL_B_8(4WXK)
DEF_HAEI8
[Raw transfer]




2PE_A_9(1BSZ)
DEF_ECOLI
[Raw transfer]




2PE_B_10(1BSZ)
DEF_ECOLI
[Raw transfer]




2PE_C_11(1BS4)
DEF_ECOLI
[Raw transfer]




FMT_D_16(4DR8)
?
[Raw transfer]




2PE_C_11(1ICJ)
DEF_ECOLI
[Raw transfer]




2PE_B_10(1ICJ)
DEF_ECOLI
[Raw transfer]




MES_A_5(1VEV)
DEF_LEPIN
[Raw transfer]




FMT_A_9(1Y6H)
DEF_LEPIN
[Raw transfer]




2PE_B_10(1BS4)
DEF_ECOLI
[Raw transfer]




2PE_A_9(1ICJ)
DEF_ECOLI
[Raw transfer]




2PE_C_11(1BSZ)
DEF_ECOLI
[Raw transfer]




2PE_A_9(1BS4)
DEF_ECOLI
[Raw transfer]




2PE_A_9(1BS4)
DEF_ECOLI
[Raw transfer]




EOH_A_4(2W3T)
DEF_ECOLI
[Raw transfer]




EOH_A_4(2W3T)
DEF_ECOLI
[Raw transfer]




TRS_A_5(1VEZ)
DEF_LEPIN
[Raw transfer]




H2S_B_7(4AL2)
DEF_ECOLI
[Raw transfer]




H2S_C_9(4AL2)
DEF_ECOLI
[Raw transfer]




H2S_A_3(4AZ4)
?
[Raw transfer]




H2S_A_5(4AL2)
DEF_ECOLI
[Raw transfer]




CHAIN_E_5(1BS6)
DEF_ECOLI
[Raw transfer]

-

CHAIN_F_6(1BS6)
DEF_ECOLI
[Raw transfer]

-

CHAIN_D_3(1ZY1)
DEF1A_ARATH
[Raw transfer]

-

CHAIN_E_5(1BS8)
DEF_ECOLI
[Raw transfer]

-

CHAIN_D_4(1BS6)
DEF_ECOLI
[Raw transfer]

-

CHAIN_E_4(4JE8)
DEF1A_ARATH
[Raw transfer]

-

CHAIN_D_4(1BS8)
DEF_ECOLI
[Raw transfer]

-

CHAIN_F_6(1BS8)
DEF_ECOLI
[Raw transfer]

-

CHAIN_D_3(4JE8)
DEF1A_ARATH
[Raw transfer]

-

CHAIN_E_4(1ZY1)
DEF1A_ARATH
[Raw transfer]

-

EDO_B_10(4DR8)
?
[Raw transfer]




EDO_B_10(4DR8)
?
[Raw transfer]




101 HHSearch 98.90100%-108 - C5 -3E3U 6.8 DEF_MYCTU
1 PsiBlast_PDB 98.90100%-108 - C5 -3E3U 6.8 DEF_MYCTU
3 PsiBlast_PDB 66.2537% -99 - C5 -1N5N 2.6 DEF_PSEAE
23 PsiBlast_CBE 66.0737% -93 - C5 -1N5N 2.0 DEF_PSEAE
113 HHSearch 65.0437% -87 - C5 -3QU1 - DEF2_VIBCH -
4 PsiBlast_PDB 64.6937% -93 - C5 -1S17 3.8 DEF_PSEAE
22 PsiBlast_CBE 64.3737% -96 - C5 -1S17 3.9 DEF_PSEAE
103 HHSearch 64.2932% -93 - C5 -4WXK 2.3 DEF_HAEI8
5 PsiBlast_PDB 64.2637% -98 - C5 -1LRY 5.9 DEF_PSEAE
106 HHSearch 64.1737% -87 - C5 -1N5N 2.6 DEF_PSEAE
84 PsiBlast_CBE 63.9132%-105 - C5 -4WXK 2.3 DEF_HAEI8
32 PsiBlast_CBE 63.6334%-102 - C5 -4AL2 2.8 DEF_ECOLI
65 PsiBlast_CBE 63.6234% -93 - C5 -1BS5 - DEF_ECOLI -
60 PsiBlast_CBE 63.6234% -94 - C5 -1BS7 - DEF_ECOLI -
33 PsiBlast_CBE 63.5934%-101 - C5 -4AL2 2.8 DEF_ECOLI
38 PsiBlast_CBE 63.3034% -92 - C5 -1XEN 3.0 DEF_ECOLI
13 PsiBlast_PDB 63.1934% -95 - C5 -2W3T 2.4 DEF_ECOLI
111 HHSearch 62.7733% -87 - C5 -2W3T 2.4 DEF_ECOLI
67 PsiBlast_CBE 62.7234% -90 - C5 -1BS4 4.5 DEF_ECOLI
44 PsiBlast_CBE 62.6734% -93 - C5 -1ICJ 4.6 DEF_ECOLI
2 PsiBlast_PDB 62.6138% -88 - C5 -1IX1 6.3 DEF_PSEAE
66 PsiBlast_CBE 62.3434% -92 - C5 -1BS4 4.6 DEF_ECOLI
47 PsiBlast_CBE 62.2034% -94 - C5 -1G2A 6.2 DEF_ECOLI
43 PsiBlast_CBE 62.1934% -90 - C5 -1ICJ 5.1 DEF_ECOLI
124 Fugue 62.1732% -84 - C5 -1G2A 6.2 DEF_ECOLI
6 PsiBlast_PDB 62.0734%-100 - C5 -3K6L 5.2 DEF_ECOLI
48 PsiBlast_CBE 62.0534% -96 - C5 -1G27 4.7 DEF_ECOLI
16 PsiBlast_PDB 61.8534% -96 - C5 -4AL2 2.8 DEF_ECOLI
37 PsiBlast_CBE 61.8034% -93 - C5 -1XEO 3.5 DEF_ECOLI
107 HHSearch 61.7732% -92 - C5 -3U04 5.0 ?
52 PsiBlast_CBE 61.7634% -94 - C5 -1BSZ 4.7 DEF_ECOLI
120 HHSearch 61.7234% -98 - C5 -4DR8 2.8 ?
18 PsiBlast_PDB 61.5834% -93 - C5 -1BS4 4.1 DEF_ECOLI
77 PsiBlast_CBE 61.5432%-102 - C5 -4WXL 5.8 DEF_HAEI8
21 PsiBlast_CBE 61.4638% -88 - C5 -1IX1 6.4 DEF_PSEAE
63 PsiBlast_CBE 61.3134% -93 - C5 -1BS6 3.8 DEF_ECOLI
49 PsiBlast_CBE 61.2234% -95 - C5 -1G27 4.7 DEF_ECOLI
39 PsiBlast_CBE 61.0534% -91 - C5 -1XEM 3.6 DEF_ECOLI
102 HHSearch 61.0132% -85 - C5 -1XEO 3.5 DEF_ECOLI
35 PsiBlast_CBE 60.9034% -95 - C5 -2AI8 4.0 DEF_ECOLI
62 PsiBlast_CBE 60.6434% -94 - C5 -1BS6 2.7 DEF_ECOLI
46 PsiBlast_CBE 60.5934% -95 - C5 -1G2A 6.4 DEF_ECOLI
17 PsiBlast_PDB 60.5734% -91 - C5 -1ICJ 3.9 DEF_ECOLI
25 PsiBlast_CBE 60.5334%-101 - C5 -3K6L 4.6 DEF_ECOLI
36 PsiBlast_CBE 60.4834% -92 - C5 -2AI8 3.8 DEF_ECOLI
51 PsiBlast_CBE 60.4434% -92 - C5 -1BSZ 3.6 DEF_ECOLI
82 PsiBlast_CBE 60.4332%-101 - C5 -4WXK 2.7 DEF_HAEI8
34 PsiBlast_CBE 60.4134% -91 - C5 -2AI8 4.2 DEF_ECOLI
14 PsiBlast_PDB 60.3034% -92 - C5 -2W3U 3.4 DEF_ECOLI
123 Fugue 60.2331% -82 - C5 -1BS4 4.1 DEF_ECOLI
29 PsiBlast_CBE 60.1434% -91 - C5 -4DR8 3.1 ?
57 PsiBlast_CBE 60.0834% -95 - C5 -1BS8 3.7 DEF_ECOLI
55 PsiBlast_CBE 60.0734% -93 - C5 -1BSJ 6.0 DEF_ECOLI
41 PsiBlast_CBE 60.0534% -92 - C5 -1LRU 6.7 DEF_ECOLI
81 PsiBlast_CBE 60.0432% -94 - C5 -4WXK 2.5 DEF_HAEI8
26 PsiBlast_CBE 60.0334% -93 - C5 -4DR9 6.8 ?
83 PsiBlast_CBE 59.9732% -97 - C5 -4WXK 2.4 DEF_HAEI8
31 PsiBlast_CBE 59.9334% -89 - C5 -4DR8 3.3 ?
11 PsiBlast_PDB 59.8734% -92 - C5 -4AZ4 2.9 ?
54 PsiBlast_CBE 59.7934% -94 - C5 -1BSK 6.1 DEF_ECOLI
99 PsiBlast_CBE 59.7434% -92 - C5 -1VEV 2.1 DEF_LEPIN
53 PsiBlast_CBE 59.5734% -91 - C5 -1BSZ 3.8 DEF_ECOLI
45 PsiBlast_CBE 59.5434% -92 - C5 -1G2A 5.9 DEF_ECOLI
56 PsiBlast_CBE 59.4834% -92 - C5 -1BS8 3.7 DEF_ECOLI
50 PsiBlast_CBE 59.4634% -93 - C5 -1G27 5.6 DEF_ECOLI
79 PsiBlast_CBE 59.2732% -98 - C5 -4WXL 4.0 DEF_HAEI8
28 PsiBlast_CBE 59.1834% -89 - C5 -4DR9 6.5 ?
40 PsiBlast_CBE 59.1334% -92 - C5 -1LRU 5.3 DEF_ECOLI
58 PsiBlast_CBE 58.8534% -91 - C5 -1BS8 4.0 DEF_ECOLI
98 PsiBlast_CBE 58.7234% -89 - C5 -1VEY 2.6 DEF_LEPIN
20 PsiBlast_PDB 58.6734% -95 - C5 -1BS6 2.9 DEF_ECOLI
100 PsiBlast_CBE 58.5534% -94 - C5 -1VEV 3.1 DEF_LEPIN
27 PsiBlast_CBE 58.3634% -94 - C5 -4DR9 6.2 ?
30 PsiBlast_CBE 58.2234% -91 - C5 -4DR8 3.3 ?
42 PsiBlast_CBE 58.0934% -93 - C5 -1LRU 5.2 DEF_ECOLI
96 PsiBlast_CBE 57.9934% -86 - C5 -1VEZ 3.2 DEF_LEPIN
93 PsiBlast_CBE 57.9434% -88 - C5 -1Y6H 3.1 DEF_LEPIN
95 PsiBlast_CBE 57.8634% -88 - C5 -1VEZ 3.2 DEF_LEPIN
9 PsiBlast_PDB 57.7034% -94 - C5 -4DR8 2.8 ?
97 PsiBlast_CBE 57.3434% -88 - C5 -1VEY 3.0 DEF_LEPIN
78 PsiBlast_CBE 57.0332% -93 - C5 -4WXL 5.0 DEF_HAEI8
94 PsiBlast_CBE 56.9234% -93 - C5 -1Y6H 3.4 DEF_LEPIN
80 PsiBlast_CBE 56.7132% -98 - C5 -4WXL 5.8 DEF_HAEI8
122 Fugue 55.5531% -79 - C5 -1G2A 6.2 DEF_ECOLI
105 HHSearch 55.2831% -82 - C5 -3UWB 6.2 ?
71 PsiBlast_CBE 53.1034% -78 - C5 -1ZY1 4.5 DEF1A_ARATH
108 HHSearch 53.0433% -75 - C5 -1Y6H 3.4 DEF_LEPIN
86 PsiBlast_CBE 52.4033% -84 - C5 -4JE8 4.1 DEF1A_ARATH
70 PsiBlast_CBE 51.3834% -77 - C5 -1ZY1 3.5 DEF1A_ARATH
85 PsiBlast_CBE 50.3033% -77 - C5 -4JE8 3.4 DEF1A_ARATH