@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu00900: (2016-06-02 )
MSYDVVIPAAGQGKRMKAGRNKLFIELKGDPVIIHTLRVFDSHRQCDKIILVINEQEREHFQQLLSDYPFQTSIELVAGGDERQHSVYKGLKAVKQEKIVLVHDGARPFIKHEQIDELIAEAEQTGAAILAVPVKDTIKRVQDLQVSETIERSSLWAVQTPQAFRLSLLMKAHAEAERKGFLGTDDASLVEQMEGGSVRVVEGSYTNIKLTTPDDLTSAEAIMESESGNKHV

Atome Classification :

(37 SA) ----.........10........20........30.......-.40....-....50........60........70.......-.80........90....---------.-----..---------.100.......110.......-120....-.-..-..130.-.......140.--.--.-.--....150.......160.......170....-...180..------......190.-......200.......210.......220.......230---------------------------------------------------------------------------------------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ----MSYDVVIPAAGQGKRMKAGRNKLFIELKGDPVIIHTLR-VFDSHRQ-CDKIILVINEQEREHFQQLLSDYPFQTSIELVA-GGDERQHSVYKGLKAVK---------Q-----EK---------IVLVHDGARPFIKHEQIDELI-A--EAEQ-T-GA-AIL-AV-PVKDTIKRV-Q--D--L-Q--VSETIERSSLWAVQTPQAFRLSLLMKAHAEA-ERKG-FLG------TDDASLVEQM-EGGSVRVVEGSYTNIKLTTPDDLTSAEAIMESESGNKHV---------------------------------------------------------------------------------------------------------------------------------------------------------
48 HHSearch 93.8838%-107 - C1 -2YC3 ISPD_ARATH A:[3-226] ----KSVSVILLAGGQG-------PKQYIPLLGQPIALYSFF-TFSRMPE-VKEIVVVCDPFFRDIFEEYEESIDV-D-LSFAI-PGKERQDSVYSGLQEIDV--------N-----SE---------LVCIHDSARPLVNTEDVEKVL-K--DGSA-V-GA-AVL-GV-PAKATIKEV-NS-D--S-L--VVKTLDRKTLWEMQTPQVIKPELLKKGFELV-KSEG-LEV------TDDVSIVEYL-K-HPVYVSQGSYTNIKVTTPDDLLLAERILSE----------------------------------------------------------------------------------------------------------------------------------------------------------------
2 PsiBlast_PDB 93.6937%-104 - C1 -2YC5 ISPD_ARATH A:[4-225] -----SVSVILLAG--------SMPKQYIPLLGQPIALYSFF-TFSRMPE-VKEIVVVCDPFFRDIFEEY--EESIDVDLSFAI-PGKERQDSVYSGLQEIDV--------N-----SE---------LVCIHDSARPLVNTEDVEKVL-K--DGSA-V-GA-AVL-GV-PAKATIKEV-NS-D--S-L--VVKTLDRKTLWEMQTPQVIKPELLKKGFELV-KSEG-LEV------TDDVSIVEYL-K-HPVYVSQGSYTNIKVTTPDDLLLAERILS-----------------------------------------------------------------------------------------------------------------------------------------------------------------
7 PsiBlast_PDB 93.0937%-107 - C1 -4NAI ISPD_ARATH A:[4-226] -----SVSVILLAG----------PKQYIPLLGQPIALYSFF-TFSRMPE-VKEIVVVCDPFFRDIFEEY--EESIDVDLRFAI-PGKERQDSVYSGLQEIDV--------N-----SE---------LVCIHDSARPLVNTEDVEKVL-K--DGSA-V-GA-AVL-GV-PAKATIKEV-NS-D--S-L--VVKTLDRKTLWEMQTPQVIKPELLKKGFELV-KSEG-LEV------TDDVSIVEYL-K-HPVYVSQGSYTNIKVTTPDDLLLAERILSE----------------------------------------------------------------------------------------------------------------------------------------------------------------
1 PsiBlast_PDB 92.4737%-102 - C1 -2YC3 ISPD_ARATH A:[4-226] -----SVSVILLAGGQG-------PKQYIPLLGQPIALYSFF-TFSRMPE-VKEIVVVCDPFFRDIFEEY--EESIDVDLSFAI-PGKERQDSVYSGLQEIDV--------N-----SE---------LVCIHDSARPLVNTEDVEKVL-K--DGSA-V-GA-AVL-GV-PAKATIKEV-NS-D--S-L--VVKTLDRKTLWEMQTPQVIKPELLKKGFELV-KSEG-LEV------TDDVSIVEYL-K-HPVYVSQGSYTNIKVTTPDDLLLAERILSE----------------------------------------------------------------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 91.0537%-112 - C1 -1W77 ISPD_ARATH A:[4-226] -----SVSVILLAGG-------SMPKQYIPLLGQPIALYSFF-TFSRMPE-VKEIVVVCDPFFRDIFEEY--EESIDVDLRFAI-PGKERQDSVYSGLQEIDV--------N-----SE---------LVCIHDSARPLVNTEDVEKVL-K--DGSA-V-GA-AVL-GV-PAKATIKEV-NS-D--S-L--VV------TLWEMQTPQVIKPELLKKGFELV-KSEG-LEV------T-DVSIVEYL-K-HPVYVSQGSYTNIKVTTPDDLLLAERILSE----------------------------------------------------------------------------------------------------------------------------------------------------------------
8 PsiBlast_PDB 90.6237%-107 - C1 -2YCM ISPD_ARATH A:[3-225] -----SVSVILLAG---------MPKQYIPLLGQPIALYSFF-TFSRMPE-VKEIVVVCDPFFRDIFEEY--EESIDVDLSFAI-PGKERQDSVYSGLQEIDV--------N-----SE---------LVCIHDSARPLVNTEDVEKVL-K--DGSA-V-GA-AVL-GV-PAKATIKEV-NS-D--S-L--VVKTL---TLWEMQTPQVIKPELLKKGFELV-KSEG-LEV------TDDVSIVEYL-K-HPVYVSQGSYTNIKVTTPDDLLLAERILSE----------------------------------------------------------------------------------------------------------------------------------------------------------------
14 PsiBlast_PDB 90.3335% -87 - C1 -4YS8 ISPD_BURTA A:[12-234] --------ALIPCAG-----GSALPKQYRTLAGRALLHYTLA-AFDACSE-FAQTLVVISPDDAHFDARRFAGLRFAVR---RC-GGASRQASVMNGLIQLA---------EFGATDAD---------WVLVHDAARPGITPALIRTLIGA--LKDD-P-VG-GIV-AL-PVADTLKRV-PAGG--D-A--IERTESRNGLWQAQTPQMFRIGMLRDAIQRA-QLEG-RDL------TDEASAIE-W-AGHTPRVVQGSLRNFKVTYPEDFDLAEAIL------------------------------------------------------------------------------------------------------------------------------------------------------------------
5 PsiBlast_PDB 89.9337%-108 - C1 -4NAN ISPD_ARATH A:[4-224] -----SVSVILLAG----------PKQYIPLLGQPIALYSFF-TFSRMPE-VKEIVVVCDPFFRDIFEEY--EESIDVDLSFAI-PGKERQDSVYSGLQEIDV--------N-----SE---------LVCIHDSARPLVNTEDVEKVL-K--DGSA-V-GA-AVL-GV-PAKATIKEV-NS-D--S-L--VVK-----TLWEMQTPQVIKPELLKKGFELV-KSEG-LEV------TDDVSIVEYL-K-HPVYVSQGSYTNIKVTTPDDLLLAERIL------------------------------------------------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 89.9237%-111 - C1 -4NAK ISPD_ARATH A:[4-224] -----SVSVILLAGG---------PKQYIPLLGQPIALYSFF-TFSRMPE-VKEIVVVCDPFFRDIFEEY--EESIDVDLSFAI-PGKERQDSVYSGLQEIDV--------N-----SE---------LVCIHDSARPLVNTEDVEKVL-K--DGSA-V-GA-AVL-GV-PAKATIKEV-NS-D--S-L--VVK-----TLWEMQTPQVIKPELLKKGFELV-KSEG-LEV------TDDVSIVEYL-K-HPVYVSQGSYTNIKVTTPDDLLLAERIL------------------------------------------------------------------------------------------------------------------------------------------------------------------
4 PsiBlast_PDB 89.6437%-109 - C1 -4NAL ISPD_ARATH A:[4-226] -----SVSVILLAGG---------PKQYIPLLGQPIALYSFF-TFSRMPE-VKEIVVVCDPFFRDIFEEY--EESIDVDLSFAI-PGKERQDSVYSGLQEIDV--------N-----SE---------LVCIHDSARPLVNTEDVEKVL-K--DGSA-V-GA-AVL-GV-PAKATIKEV-NS-D--S-L--VVKT----TLWEMQTPQVIKPELLKKGFELV-KSEG-LEV------TDDVSIVEYL-K-HPVYVSQGSYTNIKVTTPDDLLLAERILSE----------------------------------------------------------------------------------------------------------------------------------------------------------------
39 Fugue 88.8125% -99 - C1 -4CVH ISPD_HUMAN A:[1-411] SMHPQAVAAVLPAGPTPKQ--------FCPILERPLISYTLQ-ALERVCW-IKDIVVAVTGENMEVMKSIIQKYQHK-RISLVE-AGVTRHRSIFNGLKALA---------E-----DQINSKLSKPEVVIIHDAVRPFVEEGVLLKVV-T--AAKE-H-GA-AGA-IR-PLVSTVVSPSA--D--G-C--LDYSLERARHRASEMPQAFLFDVIYEAYQQCSDYDL-EFG------TECLQLALKY-CCTKAKLVEGSPDLWKVTYKRDLYAAESIIKERISQEICVVMDTEEDNKHVGHLLEEVLKSELNHVKVTSEALDQCYNFVCVNVTTSDFQETQKLLSMLEESSLCILYPVVVVSVHFLDFKLVPPSQKMENLMQIREFAKEVKERNILLYGLLISYPQDDQKLQESLRQGAIIIASLIKERNSGLIGQLLIA
55 HHSearch 88.5134% -88 - C1 -4ZDQ ISPD_BURTA A:[8-236] ----SRLFALIPCAGTGSRSGSALPKQYRTLAGRALLHYTLA-AFDACSE-FAQTLVVISPDDAHFDARRFAGLR----FAVRRCGGASRQASVMNGLIQLAEFGAT----D-----AD---------WVLVHDAARPGITPALIRTLI-G--ALKDDP-VG-GIV-AL-PVADTLKRV-PA-G--GDA--IERTESRNGLWQAQTPQMFRIGMLRDAIQRA-QLEG-RDL------TDEASAIEWA-G-HTPRVVQGSLRNFKVTYPEDFDLAEAILAH----------------------------------------------------------------------------------------------------------------------------------------------------------------
47 HHSearch 87.9127%-105 - C1 -4CVH ISPD_HUMAN A:[5-254] ----QAVAAVLPAG--------PTPKQFCPILERPLISYTLQ-ALERVCW-IKDIVVAVTGENMEVMKSIIQKYQHKR-ISLVE-AGVTRHRSIFNGLKALAEDQINSKLSK-----PE---------VVIIHDAVRPFVEEGVLLKVV-T--AAKE-H-GA-AGA-IR-PLVSTVVSP-SA-D--G-C--LDYSLERARHRASEMPQAFLFDVIYEAYQQC-SDYDLEFG------TECLQLALKYCC-TKAKLVEGSPDLWKVTYKRDLYAAESIIKERIS-------------------------------------------------------------------------------------------------------------------------------------------------------------
25 PsiBlast_CBE 87.4335% -97 - C1 -4ZDQ ISPD_BURTA D:[12-234] --------ALIPCA---------LPKQYRTLAGRALLHYTLA-AFDACSE-FAQTLVVISPDDAHFDARRFAGLRFAVR---RC-GGASRQASVMNGLIQLA---------EFGATDAD---------WVLVHDAARPGITPALIRTLIGA--LKDD-P-VG-GIV-AL-PVADTLKRV-PAGG--D-A--IERTESRNGLWQAQTPQMFRIGMLRDAIQRA-QLEG-RDL------TDEASAIE-W-AGHTPRVVQGSLRNFKVTYPEDFDLAEAIL------------------------------------------------------------------------------------------------------------------------------------------------------------------
26 PsiBlast_CBE 86.3335% -89 - C1 -4YS8 ISPD_BURTA D:[12-234] --------ALIPCAG--------------TLAGRALLHYTLA-AFDACSE-FAQTLVVISPDDAHFDARRFAGLRFAVR---RC-GGASRQASVMNGLIQLA---------EFGATDAD---------WVLVHDAARPGITPALIRTLIGA--LKDD-P-VG-GIV-AL-PVADTLKRV-PAGG--D-A--IERTESRNGLWQAQTPQMFRIGMLRDAIQRA-QLEG-RDL------TDEASAIE-W-AGHTPRVVQGSLRNFKVTYPEDFDLAEAIL------------------------------------------------------------------------------------------------------------------------------------------------------------------
64 HHSearch 86.3236% -99 - C1 -2PX7 - ISPD_THET8 A:[1-210] ----MEVSVLIPAAG--------GPKAFLQVGGRTLLEWTLA-AFRDA----AEVLVALPPGA-EPPK----GLG----AVFLE-GGATRQASVARLLEAA----------S-----LP---------LVLVHDVARPFVSRGLVARVL-E--AAQR-S-GA-AVP-VL-PVPDTLMAP-E--G--E-A--YGRVVPREAFRLVQTPQGFFTALLREAHAYA-RRKG-LEA------SDDAQLVQAL-G-YPVALVEGEATAFKITHPQDLVLAEALARV----------------------------------------------------------------------------------------------------------------------------------------------------------------
38 Fugue 86.3035% -90 - C1 -1INI ISPD_ECOLI A:[4-228] --THLDVCAVVPAAGFGRRMQTECPKQYLSIGNQTILEHSVH-ALLAHPR-VKRVVIAISPGDSRFAQLPLANHP---QITVVD-GGDERADSVLAGLKAAG---------D-----AQ---------WVLVHDAARPCLHQDDLARLL-A--LSET-S-RTGGIL-AA-PVRDTMKRA-E--P--G-KNAIAHTVDRNGLWHALTPQFFPRELLHDCLTRA-LNEG-ATI------TDEASALEYC--GFHPQLVEGRADNIKVTRPEDLALAEFYLT-----------------------------------------------------------------------------------------------------------------------------------------------------------------
13 PsiBlast_PDB 86.0635% -98 - C1 -2PX7 - ISPD_THET8 A:[1-207] ----MEVSVLIPAAG-------G-PKAFLQVGGRTLLEWTLA-AF---RD-AAEVLVALPPG---------AEPPKGLGAVFLE-GGATRQASVARLLEAAS---------L------P---------LVLVHDVARPFVSRGLVARVL-E--AAQR-S-GA-AVP-VL-PVPDTLMAP-E--G--E-A--YGRVVPREAFRLVQTPQGFFTALLREAHAYA-RRKG-LEA------SDDAQLVQAL--GYPVALVEGEATAFKITHPQDLVLAEAL-------------------------------------------------------------------------------------------------------------------------------------------------------------------
24 PsiBlast_CBE 85.9636% -96 - C1 -2XWL ? B:[2-218] -----ATVAVVPAAGSGERLRAGRPKAFVTLGGTPLLEHALS-GLRASGV-IDRIVIAVPPALTDESKLVFGG---EDSV-IVS-GGVDRTESVALALEAAG---------D-----AE---------FVLVHDAARALTPPALIARVV-A--ALKE-G-HS-AVVPGL-APADTIKAVDA--N--G-A--VLGTPERAGLRAVQTPQGFHADVLRRAYARA-TAGG-V--------TDDASLVEQL--GTPVQIVDGDPLAFKITTPLDLVLAEAVL------------------------------------------------------------------------------------------------------------------------------------------------------------------
17 PsiBlast_PDB 85.7132% -92 - C1 -1VPA ISPD_THEMA A:[17-226] ---------ILLAAGKGERMSENVPKQFLEIEGRMLFEYPLS-TFLKSEA-IDGVVIVTR---REWFEVVEKRVFHEKVLGIVE-GGDTRSQSVRSALEFLE---------KFS---PS---------YVLVHDSARPFLRKKHVSEVL-R--RARE-T-GA-ATL-AL-KNSDALVRV-E--N--D-R--I-EYIPRKGVYRILTPQAFSYEILKKAH-----ENG-GEW------ADDTEPVQKL--GVKIALVEGDPLCFKVTFKEDLELARII-------------------------------------------------------------------------------------------------------------------------------------------------------------------
15 PsiBlast_PDB 85.7035% -81 - C1 -4ZDQ ISPD_BURTA A:[12-234] --------ALIPCAGTGSRSGSALPKQYRTLAGRALLHYTLA-AFDACSE-FAQTLVVISPDDAHFDARRFAGLRFAVR---RC-GGASRQASVMNGLIQLA---------EFGATDAD---------WVLVHDAARPGITPALIRTLIGA--LKDD-P-VG-GIV-AL-PVADTLKRV-PAGG--D-A--IERTESRNGLWQAQTPQMFRIGMLRDAIQRA-QLEG-RDL------TDEASAIE-W-AGHTPRVVQGSLRNFKVTYPEDFDLAEAIL------------------------------------------------------------------------------------------------------------------------------------------------------------------
37 Fugue 84.9535% -89 - C1 -1I52 ISPD_ECOLI A:[5-229] ---HLDVCAVVPAAGFGRRMQTECPKQYLSIGNQTILEHSVH-ALLAHPR-VKRVVIAISPGDSRFAQLPLANHP---QITVVD-GGDERADSVLAGLKAAG---------D-----AQ---------WVLVHDAARPCLHQDDLARLL-A--LSET-S-RTGGIL-AA-PVRDTMKRA-E--P--G-KNAIAHTVDRNGLWHALTPQFFPRELLHDCLTRA-LNEG-ATI------TDEASALEYC--GFHPQLVEGRADNIKVTRPEDLALAEFYLTR----------------------------------------------------------------------------------------------------------------------------------------------------------------
11 PsiBlast_PDB 84.9436% -92 - C1 -2XWL ? A:[2-218] -----ATVAVVPAAGSGERLRAGRPKAFVTLGGTPLLEHALS-GLRASGV-IDRIVIAVPPALTDESKLVFGG---EDSV-IVS-GGVDRTESVALALEAAG---------D-----AE---------FVLVHDAARALTPPALIARVV-A--ALKE-G-HS-AVVPGL-APADTIKAVDA--N--G-A--VLGTPERAGLRAVQTPQGFHADVLRRAYARA-TAGG-V--------TDDASLVEQL--GTPVQIVDGDPLAFKITTPLDLVLAEAVL------------------------------------------------------------------------------------------------------------------------------------------------------------------
12 PsiBlast_PDB 84.7036% -96 - C1 -2XWM