@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2739: (2016-04-06 )
MNKLNEALKKAERIVFLTGAGVSVPSGIPDYRSKNGLYAGMSSPEYMLSHTCLVREPEKFYQFVTENMYYPNAVPNVIHKKMAEIETEKDVTIITQNIDGLHEKAGSKKVVNFHGSLYHCYCQNCGMTVTAKDYLKSDIHTDCGGVIRPDVVLYEEAISESAIDQSLTAIRKADLIVIVGTSFRVSPFCNLTDYRNKKARIFAVNKERISLPYPFEMMESDAVKVFEEI

Atome Classification :

(44 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_B_10(4TWJ)
NPD2_ARCFU
[Raw transfer]




NAD_B_25(1YC2)
NPD2_ARCFU
[Raw transfer]




NAD_A_4(2H4F)
NPD_THEMA
[Raw transfer]




NAD_C_26(1YC2)
NPD2_ARCFU
[Raw transfer]




NAD_A_4(2H4H)
NPD_THEMA
[Raw transfer]




NX6_D_12(4UUA)
SIR5_DANRE
[Raw transfer]




DZD_A_4(3D4B)
NPD_THEMA
[Raw transfer]




GOL_A_4(3U31)
SIR5_PLAF7
[Raw transfer]




OAD_B_9(4BV2)
NPD_THEMA
[Raw transfer]




FSL_C_9(4UTV)
SIR5_DANRE
[Raw transfer]




WOC_A_5(4UU8)
SIR5_DANRE
[Raw transfer]




3NP_C_12(4UTX)
SIR5_DANRE
[Raw transfer]




OAD_A_5(2H4J)
NPD_THEMA
[Raw transfer]




0L1_D_10(4UTZ)
SIR5_DANRE
[Raw transfer]




SU8_D_11(4UUB)
SIR5_DANRE
[Raw transfer]




JO3_D_12(4UU7)
SIR5_DANRE
[Raw transfer]




OAD_A_7(4BV2)
NPD_THEMA
[Raw transfer]




EDO_B_9(4UU8)
SIR5_DANRE
[Raw transfer]




OCZ_A_3(4BUZ)
NPD_THEMA
[Raw transfer]




EDO_B_9(4UUA)
SIR5_DANRE
[Raw transfer]




NCA_A_4(2H4J)
NPD_THEMA
[Raw transfer]




NCA_A_4(1YC5)
NPD_THEMA
[Raw transfer]




EDO_B_8(4UTN)
SIR5_DANRE
[Raw transfer]




EDO_B_10(4UUB)
SIR5_DANRE
[Raw transfer]




NCA_A_4(1YC5)
NPD_THEMA
[Raw transfer]




EDO_B_9(4UTZ)
SIR5_DANRE
[Raw transfer]




GUA_C_11(4UTR)
SIR5_DANRE
[Raw transfer]




EDO_B_10(4UTX)
SIR5_DANRE
[Raw transfer]




EDO_B_10(4UU7)
SIR5_DANRE
[Raw transfer]




EDO_A_6(4UU7)
SIR5_DANRE
[Raw transfer]




18 PsiBlast_PDB 91.0732%-102 - C9 -1M2G - NPD1_ARCFU -
15 PsiBlast_PDB 90.3135%-106 - C9 -2H59 - NPD_THEMA -
27 PsiBlast_CBE 90.0032%-103 - C9 -1M2J - NPD1_ARCFU -
26 PsiBlast_CBE 89.7232%-101 - C9 -1M2K - NPD1_ARCFU -
34 PsiBlast_CBE 89.6634% -98 - C9 -1S7G - NPD2_ARCFU -
23 PsiBlast_CBE 89.2032% -99 - C9 -1M2N - NPD1_ARCFU -
1 PsiBlast_PDB 88.6835%-113 - C9 -1YC5 2.9 NPD_THEMA
5 PsiBlast_PDB 88.6335%-112 - C9 -2H2F - NPD_THEMA -
25 PsiBlast_CBE 88.5432%-100 - C9 -1M2H - NPD1_ARCFU -
6 PsiBlast_PDB 88.2735%-109 - C9 -2H2G - NPD_THEMA -
20 PsiBlast_PDB 88.0932% -98 - C9 -4TWI - NPD1_ARCFU -
17 PsiBlast_PDB 88.0632%-100 - C9 -1M2N - NPD1_ARCFU -
90 Fugue 88.0228%-109 - C9 -5BTR - ? -
4 PsiBlast_PDB 88.0235%-108 - C9 -2H2D - NPD_THEMA -
7 PsiBlast_PDB 87.9835%-111 - C9 -2H2H - NPD_THEMA -
30 PsiBlast_CBE 87.8834%-102 - C9 -1YC2 - NPD2_ARCFU -
16 PsiBlast_PDB 87.7835%-112 - C9 -3JR3 - NPD_THEMA -
2 PsiBlast_PDB 87.7635%-109 - C9 -2H4F 10.1 NPD_THEMA
8 PsiBlast_PDB 87.7435%-105 - C9 -2H2I - NPD_THEMA -
13 PsiBlast_PDB 87.7335%-117 - C9 -4BV2 5.3 NPD_THEMA
57 HHSearch 87.5231%-102 - C9 -1YC5 3.1 NPD_THEMA
9 PsiBlast_PDB 87.5135%-110 - C9 -3D4B 8.2 NPD_THEMA
12 PsiBlast_PDB 86.8335%-105 - C9 -4BUZ 5.5 NPD_THEMA
21 PsiBlast_CBE 85.9735%-116 - C9 -4BV2 4.8 NPD_THEMA
14 PsiBlast_PDB 85.4135% -99 - C9 -2H4H 7.3 NPD_THEMA
3 PsiBlast_PDB 85.2035%-113 - C9 -2H4J 6.2 NPD_THEMA
32 PsiBlast_CBE 84.7034% -92 - C9 -1YC2 10.5 NPD2_ARCFU
31 PsiBlast_CBE 84.4634% -92 - C9 -1YC2 10.5 NPD2_ARCFU
46 PsiBlast_CBE 83.2431% -87 - C9 -4UTZ 3.0 SIR5_DANRE
28 PsiBlast_CBE 83.1534%-106 - C9 -4TWJ Error NPD2_ARCFU
49 PsiBlast_CBE 83.1231% -84 - C9 -4UTX 2.6 SIR5_DANRE
44 PsiBlast_CBE 82.4531% -84 - C9 -4UU7 2.9 SIR5_DANRE
42 PsiBlast_CBE 82.4331% -86 - C9 -4UU8 3.1 SIR5_DANRE
47 PsiBlast_CBE 82.3731% -85 - C9 -4UTZ 2.8 SIR5_DANRE
48 PsiBlast_CBE 82.3631% -83 - C9 -4UTX 2.1 SIR5_DANRE
40 PsiBlast_CBE 82.2331% -83 - C9 -4UUA 3.1 SIR5_DANRE
38 PsiBlast_CBE 82.1831% -86 - C9 -4UUB 3.1 SIR5_DANRE
43 PsiBlast_CBE 82.1631% -85 - C9 -4UU8 3.0 SIR5_DANRE
54 PsiBlast_CBE 82.0831% -86 - C9 -4UTN 3.1 SIR5_DANRE
41 PsiBlast_CBE 81.9531% -84 - C9 -4UUA 3.0 SIR5_DANRE
53 PsiBlast_CBE 81.6531% -84 - C9 -4UTR 2.6 SIR5_DANRE
45 PsiBlast_CBE 81.3131% -84 - C9 -4UU7 4.0 SIR5_DANRE
51 PsiBlast_CBE 81.0531% -85 - C9 -4UTV 2.8 SIR5_DANRE
39 PsiBlast_CBE 80.8631% -87 - C9 -4UUB 3.0 SIR5_DANRE