@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA3717: (2016-02-20 )
MNDRLQIEDLLLGDGKEVVKGALITTQYKGTLEDGTLFDSSYERGRPFQCVIGTGRVIKGWDQGLMGMKVGGKRRLFVPSHLAYGERQVGAHIKPHSNLLFEIELLEVLTRDD

Atome Classification :

(52 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

861_A_9(4GGQ)
SMT3_YEAST
[Raw transfer]




861_B_6(4G50)

[Raw transfer]




4GI_B_6(4GIV)

[Raw transfer]




ARD_C_3(3FAP)
FKB1A_HUMAN
[Raw transfer]




861_D_11(4GGQ)

[Raw transfer]




FK5_B_4(4NNR)
FKBP2_HUMAN
[Raw transfer]




854_B_4(4FN2)

[Raw transfer]




FK5_A_2(3UF8)

[Raw transfer]




FK5_A_3(4DZ3)
?
[Raw transfer]




FK5_B_9(4DZ3)
?
[Raw transfer]




FK5_A_2(3UF8)

[Raw transfer]




FK5_B_2(1YAT)
FKBP_YEAST
[Raw transfer]




4GI_A_3(4GIV)
SMT3_YEAST
[Raw transfer]




FK5_B_2(1YAT)
FKBP_YEAST
[Raw transfer]




861_B_10(4GGQ)
SMT3_YEAST
[Raw transfer]




SB1_D_4(1FKI)
FKB1A_HUMAN
[Raw transfer]




FK5_A_2(3VAW)

[Raw transfer]




854_A_3(4FN2)
SMT3_YEAST
[Raw transfer]




RAD_C_3(1NSG)
FKB1A_HUMAN
[Raw transfer]




RAD_A_3(2FAP)
FKB1A_HUMAN
[Raw transfer]




FK5_A_2(3UQB)

[Raw transfer]




ARD_C_3(4FAP)
FKB1A_HUMAN
[Raw transfer]




861_C_6(4GGQ)
SMT3_YEAST
[Raw transfer]




SB3_B_2(1FKG)
FKB1A_HUMAN
[Raw transfer]




FK5_B_5(4DZ2)
?
[Raw transfer]




RAP_A_2(3KZ7)
FKBP3_MOUSE
[Raw transfer]




861_A_3(4G50)
SMT3_YEAST
[Raw transfer]




RAP_B_2(1PBK)
FKBP3_HUMAN
[Raw transfer]




FK5_A_2(3UQA)

[Raw transfer]




TST_B_2(1J4I)
FKB1A_HUMAN
[Raw transfer]




RAP_A_2(3KZ7)
FKBP3_MOUSE
[Raw transfer]




858_C_3(1QPF)
FKB1A_HUMAN
[Raw transfer]




001_B_7(1J4R)
FKB1A_HUMAN
[Raw transfer]




001_A_6(1J4R)
FKB1A_HUMAN
[Raw transfer]




DMS_H_8(1D7H)
FKB1A_HUMAN
[Raw transfer]




DSS_H_8(1D7I)
FKB1A_HUMAN
[Raw transfer]




BUQ_B_8(1D7J)
FKB1A_HUMAN
[Raw transfer]




PEG_C_7(2PBC)
FKBP2_HUMAN
[Raw transfer]




BUQ_A_7(1D7J)
FKB1A_HUMAN
[Raw transfer]




PEG_B_6(2PBC)
FKBP2_HUMAN
[Raw transfer]




PEG_A_5(2PBC)
FKBP2_HUMAN
[Raw transfer]




PEG_A_5(2PBC)
FKBP2_HUMAN
[Raw transfer]




TAR_A_2(3OE2)
?
[Raw transfer]




PEG_D_8(2PBC)
FKBP2_HUMAN
[Raw transfer]




MPO_A_2(3UQI)
?
[Raw transfer]




DMS_A_3(3O5Q)
FKBP5_HUMAN
[Raw transfer]




DSS_G_7(1D7I)
FKB1A_HUMAN
[Raw transfer]




DMS_G_7(1D7H)
FKB1A_HUMAN
[Raw transfer]




SRT_A_3(3OE2)
?
[Raw transfer]




FK5_B_5(4DZ2)
?
[Raw transfer]




113 HHSearch 89.3848% -90 - C3 -1YAT 8.1 FKBP_YEAST
13 PsiBlast_PDB 89.2549% -96 - C3 -1Y0O - FKB13_ARATH -
11 PsiBlast_PDB 89.1550% -96 - C3 -1YAT 8.1 FKBP_YEAST
127 HHSearch 88.8152% -90 - C3 -1U79 - FKB13_ARATH -
22 PsiBlast_CBE 88.6351% -94 - C3 -4GGQ 7.1
4 PsiBlast_PDB 88.4951% -95 - C3 -3VAW 8.2
120 HHSearch 88.3850% -85 - C3 -3UF8 8.7
6 PsiBlast_PDB 87.0350% -92 - C3 -3UF8 8.7
21 PsiBlast_CBE 86.9551% -93 - C3 -4DZ3 8.3 ?
24 PsiBlast_CBE 86.8551% -93 - C3 -4GGQ 6.6 SMT3_YEAST
23 PsiBlast_CBE 86.8051% -93 - C3 -4GGQ 6.8 SMT3_YEAST
2 PsiBlast_PDB 86.6051% -94 - C3 -4DZ3 8.3 ?
27 PsiBlast_CBE 86.5450% -98 - C3 -4FN2 5.2
1 PsiBlast_PDB 86.4351% -93 - C3 -3UQA 8.3
14 PsiBlast_PDB 86.0050% -97 - C3 -4DZ2 2.2 ?
5 PsiBlast_PDB 85.8351% -89 - C3 -4GGQ 7.1 SMT3_YEAST
12 PsiBlast_PDB 85.8049% -97 - C3 -1U79 - FKB13_ARATH -
7 PsiBlast_PDB 85.6550% -99 - C3 -3UQB 6.9
26 PsiBlast_CBE 85.3050% -94 - C3 -4G50 5.8
8 PsiBlast_PDB 84.3050% -94 - C3 -4FN2 5.6 SMT3_YEAST
9 PsiBlast_PDB 84.2850% -93 - C3 -4G50 7.1 SMT3_YEAST
25 PsiBlast_CBE 83.9250% -95 - C3 -4GIV 4.0
28 PsiBlast_CBE 83.9150% -95 - C3 -4DZ2 8.4 ?
10 PsiBlast_PDB 83.1350% -86 - C3 -4GIV 4.8 SMT3_YEAST
18 PsiBlast_PDB 81.4841% -98 - C3 -3UQI 3.1 ?
32 PsiBlast_CBE 80.2951%-114 - C3 -4NNR 7.7 FKBP2_HUMAN
55 PsiBlast_CBE 80.0539%-102 - C3 -1FKG 7.6 FKB1A_HUMAN
130 HHSearch 79.8236% -88 - C3 -3KZ7 6.8 FKBP3_MOUSE
45 PsiBlast_CBE 79.6739%-104 - C3 -1NSG 8.8 FKB1A_HUMAN
39 PsiBlast_CBE 79.6739%-104 - C3 -2FAP 7.9 FKB1A_HUMAN
31 PsiBlast_CBE 78.7451%-105 - C3 -2PBC 2.1 FKBP2_HUMAN
63 PsiBlast_CBE 78.7139%-100 - C3 -1D7H 3.7 FKB1A_HUMAN
134 HHSearch 78.4549% -96 - C3 -2PBC 2.1 FKBP2_HUMAN
35 PsiBlast_CBE 78.3739%-104 - C3 -4FAP 8.1 FKB1A_HUMAN
53 PsiBlast_CBE 78.3139%-100 - C3 -1FKI 7.2 FKB1A_HUMAN
60 PsiBlast_CBE 77.9139% -97 - C3 -1D7J 2.5 FKB1A_HUMAN
37 PsiBlast_CBE 77.8339% -97 - C3 -3FAP 8.2 FKB1A_HUMAN
47 PsiBlast_CBE 77.7439% -89 - C3 -1J4R 7.9 FKB1A_HUMAN
48 PsiBlast_CBE 77.5239% -96 - C3 -1J4R 7.8 FKB1A_HUMAN
59 PsiBlast_CBE 77.3039% -97 - C3 -1D7J 2.5 FKB1A_HUMAN
30 PsiBlast_CBE 77.1551%-103 - C3 -2PBC 2.0 FKBP2_HUMAN
64 PsiBlast_CBE 77.0439% -98 - C3 -1D7H 2.5 FKB1A_HUMAN
44 PsiBlast_CBE 76.9139% -95 - C3 -1QPF 7.9 FKB1A_HUMAN
62 PsiBlast_CBE 76.8739% -99 - C3 -1D7I 2.6 FKB1A_HUMAN
29 PsiBlast_CBE 75.9551%-101 - C3 -2PBC 2.2 FKBP2_HUMAN
15 PsiBlast_PDB 75.9451% -99 - C3 -2PBC 2.1 FKBP2_HUMAN
61 PsiBlast_CBE 75.5939% -99 - C3 -1D7I 2.7 FKB1A_HUMAN
49 PsiBlast_CBE 73.3939% -97 - C3 -1J4I 4.7 FKB1A_HUMAN
114 HHSearch 70.6536%-102 - C3 -3OE2 2.7 ?
75 PsiBlast_CBE 69.1038%-112 - C3 -3KZ7 7.2 FKBP3_MOUSE
124 HHSearch 68.9535% -89 - C3 -3O5Q 2.4 FKBP5_HUMAN
76 PsiBlast_CBE 68.0138%-114 - C3 -1PBK 8.2 FKBP3_HUMAN