@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA0750: (2016-01-17 )
MTDNDDRIKLEASWKEALREEFDKPYMKQLGEFLRQEKAAGKVIFPPGPLIFNALNTTPLENVKVVIIGQDPYHGPGQAHGLCFSVQPGVPTPPSLQNIYKELNRDLNIPIPNNGYLQRWAEQGVLLLNTSLTVEQAKAGSHANAGWQPFTDRVIEVVNERCERLVFLLWGSHAQSKQKLIDPQRHLILKSAHPSPLSAYRGFLGNGHFSRTNKFLEQNGKTPIDWSLPDL

Atome Classification :

(59 SA) .........10........20----........30.........40........50........60........70........80........90.........100.-....-.-.110........120.......130.......140.-.-.....150.......160-.......170.......180.......190.....-------..200-----.........210.......220.......230
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTDNDDRIKLEASWKEALREE----FDKPYMKQL-GEFLRQEKAAGKVIFPPGPLIFNALNTTPLENVKVVIIGQDPYHGPGQAHGLCFSVQPGV-PTPPSLQNIYKEL-NRDL-N-IPI-PNNGYLQRWAEQGVLLLNTSLTVEQAKAGSHA-N-AGWQPFTDRVIEVVNERC-ERLVFLLWGSHAQSKQKLIDPQRHLILKSAHPSPL-------SAY-------RGFLGNGHFSRTNKFLEQNGKTPIDWSLPDL-
3 PsiBlast_PDB 93.4454% -94 - C8 -3ZOQ UNG_BACSU A:[5-225] ---------LQDSWWNQLKEE----FEKPYYQEL-REMLKREYAE-QTIYPDSRDIFNALHYTSYDDVKVVILGQDPYHGPGQAQGLSFSVKPGV-KQPPSLKNIFLEL-QQDI-G-CSI-PNHGSLVSWAKQGVLLLNTVLTVRRGQANSHK-G-KGWERLTDRIIDVLSERE-RPVIFILWGRHAQMKKERIDTSKHFIIESTHPSPF-------SAR-------NGFFGSRPFSRANAYLEKMGEAPIDWCIKDL-
4 PsiBlast_PDB 93.3454% -92 - C8 -3ZOR - UNG_BACSU A:[5-225] ---------LQDSWWNQLKEE----FEKPYYQEL-REMLKREYAE-QTIYPDSRDIFNALHYTSYDDVKVVILGQDPYHGPGQAQGLSFSVKPGV-KQPPSLKNIFLEL-QQDI-G-CSI-PNHGSLVSWAKQGVLLLNTVLTVRRGQANSHK-G-KGWERLTDRIIDVLSERE-RPVIFILWGRHAQMKKERIDTSKHFIIESTHPSPF-------SAR-------NGFFGSRPFSRANAYLEKMGEAPIDWCIKDL-
2 PsiBlast_PDB 93.2758% -89 - C8 -2JHQ UNG_VIBCH A:[6-224] ------------TWHDVIGNE----KQQAYFQQT-LQFVESQRQAGKVIYPPAKDVFNAFRFTEFGDVKVVILGQDPYHGPNQAHGLCFSVLPGV-KTPPSLVNIYKEL-AQDIPG-FQI-PPHGYLQSWAQQGVLLLNTVLTVEQGMAHSHA-N-TGWETFTDRVIDALNQHR-NGLIFLLWGSHAQKKGQMIDRQRHHVLMAPHPSPL-------SAH-------RGFLGCRHFSKTNQLLQAQGIAPINWQ-PEL-
6 PsiBlast_PDB 92.8756% -91 - C8 -1UUG - UNG_ECOLI A:[5-220] -----------LTWHDVLAEE----KQQPYFLNT-LQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGI-AIPPSLLNMYKEL-ENTIPG-FTR-PNHGYLESWARQGVLLLNTVLTVRAGQAHSHA-S-LGWETFTDKVISLINQHR-EGVVFLLWGSHAQKKGAIIDKQRHHVLKAPHPSPL-------SAH-------RGFFGCNHFVLANQWLEQRGETPIDWMPVLP-
66 Fugue 92.8355% -89 - C8 -1UUG - UNG_ECOLI A:[5-226] -----------LTWHDVLAEE----KQQPYFLNT-LQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGI-AIPPSLLNMYKEL-ENTIPG-FTR-PNHGYLESWARQGVLLLNTVLTVRAGQAHSHA-S-LGWETFTDKVISLINQHR-EGVVFLLWGSHAQKKGAIIDKQRHHVLKAPHPSPL-------SAH-------RGFFGCNHFVLANQWLEQRGETPIDWMPVLPA
15 PsiBlast_PDB 92.6755% -94 - C8 -4EUG - UNG_ECOLI A:[5-220] -----------LTWHDVLAEE----KQQPYFLNT-LQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGI-AIPPSLLNMYKEL-ENTIPG-FTR-PNHGYLESWARQGVLLLNTVLTVRAGQAHSHA-S-LGWETFTDKVISLINQHR-EGVVFLLWGSHAQKKGAIIDKQRHHVLKAPQPSPL-------SAH-------RGFFGCNHFVLANQWLEQHGETPIDWMPVLP-
13 PsiBlast_PDB 92.4855% -90 - C8 -3EUG UNG_ECOLI A:[5-220] -----------LTWHDVLAEE----KQQPHFLNT-LQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGI-AIPPSLLNMYKEL-ENTIPG-FTR-PNHGYLESWARQGVLLLNTVLTVRAGQAHSHA-S-LGWETFTDKVISLINQHR-EGVVFLLWGSHAQKKGAIIDKQRHHVLKAPHPSPL-------SAH-------RGFFGCNHFVLANQWLEQHGETPIDWMPVLP-
24 PsiBlast_CBE 92.4753% -91 - C8 -3FCI UNG_HUMAN A:[7-220] ------------SWKKHLSGE----FGKPYFIKL-MGFVAEERKH-YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPV-PPPPSLENIYKEL-STDIED-FVH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSHK-E-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL-------SVY-------RGFFGCRHFSKTNELLQKSGKKPIDWKEL---
20 PsiBlast_PDB 92.4755% -88 - C8 -2BOO UNG_DEIRA A:[23-241] ---------LPEDWQEALLPE----FSAPYFHEL-TDFLRQERKE-YTIYPPAPDVFNALRYTPLGEVKVLILGQDPYHGPNQAHGLSFSVRPGV-RVPPSLRNIYKEL-TEDIPG-FVA-PKHGYLRSWAEQGVLLLNAVLTVRAGQANSHQ-G-KGWEHFTDAVIKAVNAKE-ERVVFILWGSYARKKKKLITGKNHVVIESGHPSPL-------SE--------QYFFGTRPFSKTNEALEKAGRGPVEWQLPAT-
32 PsiBlast_CBE 92.1253% -93 - C8 -1EMH UNG_HUMAN A:[7-220] ------------SWKKHLSGE----FGKPYFIKL-MGFVAEERKH-YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPV-PPPPSLENIYKEL-STDIED-FVH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSHK-E-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL-------SVY-------RGFFGCRHFSKTNELLQKSGKKPIDWKEL---
5 PsiBlast_PDB 92.0756% -92 - C8 -1EUG - UNG_ECOLI A:[5-220] -----------LTWHDVLAEE----KQQPYFLNT-LQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGI-AIPPSLLNMYKEL-ENTIPG-FTR-PNHGYLESWARQGVLLLNTVLTVRAGQAHSHA-S-LGWETFTDKVISLINQHR-EGVVFLLWGSHAQKKGAIIDKQRHHVLKAPHPSPL-------SAH-------RGFFGCNHFVLANQWLEQHGETPIDWMPVLP-
26 PsiBlast_CBE 92.0353% -91 - C8 -2OYT UNG_HUMAN A:[7-220] ------------SWKKHLSGE----FGKPYFIKL-MGFVAEERKH-YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPV-PPPPSLENIYKEL-STDIED-FVH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSHK-E-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL-------SVY-------RGFFGCRHFSKTNELLQKSGKKPIDWKEL---
29 PsiBlast_CBE 91.9453% -90 - C8 -1SSP UNG_HUMAN E:[7-220] ------------SWKKHLSGE----FGKPYFIKL-MGFVAEERKH-YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPV-PPPPSLENIYKEL-STDIED-FVH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSHK-E-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL-------SVY-------RGFFGCRHFSKTNELLQKSGKKPIDWKEL---
25 PsiBlast_CBE 91.8853% -90 - C8 -3FCF UNG_HUMAN A:[7-220] ------------SWKKHLSGE----FGKPYFIKL-MGFVAEERKH-YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPV-PPPPSLENIYKEL-STDIED-FVH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSHK-E-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL-------SVY-------RGFFGCRHFSKTNELLQKSGKKPIDWKEL---
34 PsiBlast_CBE 91.7753% -89 - C8 -2SSP UNG_HUMAN E:[7-220] ------------SWKKHLSGE----FGKPYFIKL-MGFVAEERKH-YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPV-PPPPSLENIYKEL-STDIED-FVH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSHK-E-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPA-------SVY-------RGFFGCRHFSKTNELLQKSGKKPIDWKEL---
21 PsiBlast_CBE 91.7453% -91 - C8 -3FCL UNG_HUMAN B:[7-220] ------------SWKKHLSGE----FGKPYFIKL-MGFVAEERKH-YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPV-PPPPSLENIYKEL-STDIED-FVH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSHK-E-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL-------SVY-------RGFFGCRHFSKTNELLQKSGKKPIDWKEL---
19 PsiBlast_PDB 91.7155% -93 - C8 -3UFM UNG_DEIRA A:[23-241] ---------LPEDWQEALLPE----FSAPYFHEL-TDFLRQERKE-YTIYPPAPDVFNALRYTPLGEVKVLILGQDPYHGPNQAHGLSFSVRPGV-RVPPSLRNIYKEL-TEDIPG-FVA-PKHGYLRSWAEQGVLLLNAVLTVRAGQANSHQ-G-KGWEHFTDAVIKAVNAKE-ERVVFILWGSYARKKKKLITGKNHVVIESGHPSPL-------SE--------QYFFGTRPFSKTNEALEKAGRGPVEWQLPAT-
76 HHSearch 91.6652% -88 * C8 *3FCI UNG_HUMAN A:[2-223] -------EFFGESWKKHLSGE----FGKPYFIKL-MGFVAEERK-HYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPV-PPPPSLENIYKEL-STDI-EDFVH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSHK-E-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL-------SVY-------RGFFGCRHFSKTNELLQKSGKKPIDWKEL---
77 HHSearch 91.6455% -89 - C8 -3UF7 UNG_ECOLI A:[3-224] ---------NELTWHDVLAEE----KQQPYFLNT-LQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGI-AIPPSLLNMYKEL-ENTI-PGFTR-PNHGYLESWARQGVLLLNTVLTVRAGQAHSHA-S-LGWETFTDKVISLINQHR-EGVVFLLWGSHAQKKGAIIDKQRHHVLKAPHPSPL-------SAH-------RGFFGCNHFVLANQWLEQRGETPIDWMPVLP-
23 PsiBlast_CBE 91.6153% -91 - C8 -3FCK UNG_HUMAN B:[7-220] ------------SWKKHLSGE----FGKPYFIKL-MGFVAEERKH-YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPV-PPPPSLENIYKEL-STDIED-FVH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSHK-E-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL-------SVY-------RGFFGCRHFSKTNELLQKSGKKPIDWKEL---
28 PsiBlast_CBE 91.5353% -88 - C8 -2HXM UNG_HUMAN A:[7-220] ------------SWKKHLSGE----FGKPYFIKL-MGFVAEERKH-YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPV-PPPPSLENIYKEL-STDIED-FVH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSHK-E-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL-------SVY-------RGFFGCRHFSKTNELLQKSGKKPIDWKEL---
27 PsiBlast_CBE 91.4453% -89 - C8 -2OXM UNG_HUMAN A:[7-220] ------------SWKKHLSGE----FGKPYFIKL-MGFVAEERKH-YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPV-PPPPSLENIYKEL-STDIED-FVH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSHK-E-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL-------SVY-------RGFFGCRHFSKTNELLQKSGKKPIDWKEL---
16 PsiBlast_PDB 91.3355% -89 - C8 -5EUG UNG_ECOLI A:[5-220] -----------LTWHDVLAEE----KQQPYFLNT-LQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGI-AIPPSLLNMYKEL-ENTIPG-FTR-PNHGYLESWARQGVLLLNTVLTVRAGQAHSHA-S-LGWETFTDKVISLINQHR-EGVVFLLWGSHAQKKGAIIDKQRHHVLKAPQPSPL-------SAH-------RGFFGCNHFVLANQWLEQHGETPIDWMPVLP-
11 PsiBlast_PDB 91.3356% -89 - C8 -3UF7 UNG_ECOLI A:[4-220] ----------ELTWHDVLAEE----KQQPYFLNT-LQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGI-AIPPSLLNMYKEL-ENTIPG-FTR-PNHGYLESWARQGVLLLNTVLTVRAGQAHSHA-S-LGWETFTDKVISLINQHR-EGVVFLLWGSHAQKKGAIIDKQRHHVLKAPHPSPL-------SAH-------RGFFGCNHFVLANQWLEQRGETPIDWMPVLP-
30 PsiBlast_CBE 91.1453% -90 - C8 -1Q3F UNG_HUMAN A:[7-220] ------------SWKKHLSGE----FGKPYFIKL-MGFVAEERKH-YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPV-PPPPSLENIYKEL-STDIED-FVH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSHK-E-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL-------SVY-------RGFFGCRHFSKTNELLQKSGKKPIDWKEL---
12 PsiBlast_PDB 91.0855% -91 - C8 -2EUG UNG_ECOLI A:[5-220] -----------LTWHDVLAEE----KQQPHFLNT-LQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGI-AIPPSLLNMYKEL-ENTIPG-FTR-PNHGYLESWARQGVLLLNTVLTVRAGQAHSHA-S-LGWETFTDKVISLINQHR-EGVVFLLWGSHAQKKGAIIDKQRHHVLKAPHPSPL-------SAH-------RGFFGCNHFVLANQWLEQHGETPIDWMPVLP-
33 PsiBlast_CBE 91.0753% -86 - C8 -3TKB UNG_HUMAN A:[7-220] ------------SWKKHLSGE----FGKPYFIKL-MGFVAEERKH-YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPV-PPPPSLENIYKEL-STDI-E-GFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHK-E-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL-------SVY-------RGFFGCRHFSKTNELLQKSGKKPIDWREL---
18 PsiBlast_PDB 90.9856% -84 - C8 -4UQM ? A:[23-241] ---------LPEDWQEALLPE----FSAPYFHEL-TDFLRQERKE-YTIYPPAPDVFNALRYTPLGEVKVLILGQDPYHGPNQAHGLSFSVRPGV-RVPPSLRNIYKEL-TEDIPG-FVA-PKHGYLRSWAEQGVLLLNAVLTVRAAQANSHQ-G-KGWEHFTDAVIKAVNAKE-ERVVFILWGSYARKKKKLITGKNHVVIESGHPSPL-------SE--------QYFFGTRPFSKTNEALEKAGRGPVEWQLPAT-
37 PsiBlast_CBE 90.9451% -85 - C8 -1OKB ? A:[7-220] ------------TWRRELAAE----FEKPYFKQL-MSFVADERSR-HTVYPPADQVYSWTEMCDIQDVKVVILGQDPYHGPNQAHGLCFSVQKPV-PPPPSLVNIYKEL-CTDI-DGFKH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSHK-D-RGWETFTDAVIKWLSVNR-EGVVFLLWGSYAHKKGATIDRKRHHVLQAVHPSPL-------SAH-------RGFLGCKHFSKANGLLKLSGTEPINWRAL---
36 PsiBlast_CBE 90.9051% -85 - C8 -1OKB ? B:[7-220] ------------TWRRELAAE----FEKPYFKQL-MSFVADERSR-HTVYPPADQVYSWTEMCDIQDVKVVILGQDPYHGPNQAHGLCFSVQKPV-PPPPSLVNIYKEL-CTDI-DGFKH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSHK-D-RGWETFTDAVIKWLSVNR-EGVVFLLWGSYAHKKGATIDRKRHHVLQAVHPSPL-------SAH-------RGFLGCKHFSKANGLLKLSGTEPINWRAL---
31 PsiBlast_CBE 90.7953% -91 - C8 -1EMJ UNG_HUMAN A:[7-220] ------------SWKKHLSGE----FGKPYFIKL-MGFVAEERKH-YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPV-PPPPSLENIYKEL-STDIED-FVH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSHK-E-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL-------SVY-------RGFFGCRHFSKTNELLQKSGKKPIDWKEL---
22 PsiBlast_CBE 90.7953% -87 - C8 -3FCL UNG_HUMAN A:[7-220] ------------SWKKHLSGE----FGKPYFIKL-MGFVAEERKH-YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPV-PPPPSLENIYKEL-STDIED-FVH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSHK-E-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL-------SVY-------RGFFGCRHFSKTNELLQKSGKKPIDWKEL---
14 PsiBlast_PDB 90.6955% -90 - C8 -1FLZ UNG_ECOLI A:[3-219] ----------ELTWHDVLAEE----KQQPHFLNT-LQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGI-AIPPSLLNMYKEL-ENTIPG-FTR-PNHGYLESWARQGVLLLNTVLTVRAGQAHSHA-S-LGWETFTDKVISLINQHR-EGVVFLLWGSHAQKKGAIIDKQRHHVLKAPHPSPL-------SAH-------RGFFGCNHFVLANQWLEQHGETPIDWMPVLP-
35 PsiBlast_CBE 90.6053% -89 - C8 -4SKN UNG_HUMAN E:[7-220] ------------SWKKHLSGE----FGKPYFIKL-MGFVAEERKH-YTVYPPPHQVFTWTQMCDIKDVKVVILGQNPYHGPNQAHGLCFSVQRPV-PPPPSLENIYKEL-STDIED-FVH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSHK-E-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPR-------SVY-------RGFFGCRHFSKTNELLQKSGKKPIDWKEL---
78 HHSearch 89.7250% -83 - C8 -3CXM ? A:[33-263] ------GLITNPEWRDFLAPITADSWRKGAFIRI-ERFLDEEKEKGRVILPPAADIFNAFNSCPFRGLKVVLLGQDPYHDLHQAHGLCFSVLPEV-PLPPSLRNIYKEL-TTDIAG-FQA-PKHGYLQSWSEQGMLMLNATLTVEAHKANSHS-KTSGWAAFTDAVIQHLSQHHPNRLVFLLWGGYAQQKKRLIDANRHVVLENVHPSPL-------SAN-------RGWFGCRCFSACNEALQRMSHLPMHWQLPLN-
44 PsiBlast_CBE 89.2044% -97 - C8 -4WS5 ? A:[21-238] ---------VERGWAAALEPV----ADQ--VAHM-GQFLRAEIAAGRRYLPAGSNVLRAF-TFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEY-TADL-G-YPL-PSNGDLTPWAQRGVLLLNRVLTVRPSNPASHR-G-KGWEAVTECAIRALAARA-APLVAILWGRDASTLKPMLAAGNCVAIESPHPSPL-------SAS-------RGFFGSRPFSRANELLVGMGAEPIDWRLP---
58 PsiBlast_CBE 89.0744% -94 - C8 -3A7N UNG_MYCTU A:[21-238] ---------VERGWAAALEPV----ADQ--VAHM-GQFLRAEIAAGRRYLPAGSNVLRAF-TFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEY-TADL-G-YPL-PSNGDLTPWAQRGVLLLNRVLTVRPSNPASHR-G-KGWEAVTECAIRALAARA-APLVAILWGRDASTLKPMLAAGNCVAIESPHPSPL-------SAS-------RGFFGSRPFSRANELLVGMGAEPIDWRLP---
55 PsiBlast_CBE 88.3444% -91 - C8 -4WRU ? A:[21-238] ---------VERGWAAALEPV----ADQ--VAHM-GQFLRAEIAAGRRYLPAGSNVLRAF-TFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEY-TADL-G-YPL-PSNGDLTPWAQRGVLLLNRVLTVRPSNPASHR-G-KGWEAVTECAIRALAARA-APLVAILWGRDASTLKPMLAAGNCVAIESPHPSPL-------SAS-------RGFFGSRPFSRANELLVGMGAEPIDWRLP---
80 HHSearch 88.0945% -88 - C8 -2J8X UNG_EBVB9 A:[3-231] ------NLLLPDLWLDFLQLSP---IFQRKLAAV-IACVRRLR-TQATVYPEEDMCMAWARFCDPSDIKVVILGQDPYHG-GQANGLAFSVAYGF-PVPPSLRNIYAEL-HRSL-PEFSP-PDHGCLDAWASQGVLLLNTILTVQKGKPGSHA-D-IGWAWFTDHVISLLSERL-KACVFMLWGAKAGDKASLINSKKHLVLTSQHPSPL-------AQNSTRKSAQQKFLGNNHFVLANNFLREKGLGEIDWRL----
48 PsiBlast_CBE 87.8644% -92 - C8 -4WS1 ? A:[21-238] ---------VERGWAAALEPV----ADQ--VAHM-GQFLRAEIAAGRRYLPAGSNVLRAF-TFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEY-TADL-G-YPL-PSNGDLTPWAQRGVLLLNRVLTVRPSNPASHR-G-KGWEAVTECAIRALAARA-APLVAILWGRDASTLKPMLAAGNCVAIESPHPSPL-------SAS-------RGFFGSRPFSRANELLVGMGAEPIDWRLP---
49 PsiBlast_CBE 87.8344% -90 - C8 -4WS0 ? A:[21-238] ---------VERGWAAALEPV----ADQ--VAHM-GQFLRAEIAAGRRYLPAGSNVLRAF-TFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEY-TADL-G-YPL-PSNGDLTPWAQRGVLLLNRVLTVRPSNPASHR-G-KGWEAVTECAIRALAARA-APLVAILWGRDASTLKPMLAAGNCVAIESPHPSPL-------SAS-------RGFFGSRPFSRANELLVGMGAEPIDWRLP---