@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv2321c: (2016-05-09 )
MIADEIQSGLACTGYPFACDHGGVLPDIYLLGKTLGGGAVPLSAMVADREIFGVVHPGEHGSTFGGNPLAAAIGTPVVSMVVWGECQARSAKLGAHLHQRLADLIGDGAVALRGLGWWADVDIERALAIGTDMSMRLADRGVLLKDTYGAALRFAPPLVITAQEIDCAVRRFADALWEAGS

Atome Classification :

(68 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LCS_A_4(1D7U)
DGDA_BURCE
[Raw transfer]




DCS_A_4(1D7S)
DGDA_BURCE
[Raw transfer]




NMA_A_4(1D7V)
DGDA_BURCE
[Raw transfer]




PFM_A_5(2OAT)
OAT_HUMAN
[Raw transfer]




PLP_A_3(4NOG)
?
[Raw transfer]




PFM_A_5(2OAT)
OAT_HUMAN
[Raw transfer]




PLP_B_5(4NOG)
?
[Raw transfer]




PLP_A_3(4NOG)
?
[Raw transfer]




PLP_B_6(1S07)
BIOA_ECOLI
[Raw transfer]




PFM_B_6(2OAT)
OAT_HUMAN
[Raw transfer]




PLP_B_10(4ZWM)
?
[Raw transfer]




PFM_C_7(2OAT)
OAT_HUMAN
[Raw transfer]




PLP_B_8(1MLZ)
BIOA_ECOLI
[Raw transfer]




POI_C_3(1WKG)
ARGD_THET8
[Raw transfer]




PLP_A_5(2BYJ)
OAT_HUMAN
[Raw transfer]




POI_D_4(1WKG)
ARGD_THET8
[Raw transfer]




PLP_A_3(4ZLV)
?
[Raw transfer]




PLP_B_8(1MLY)
BIOA_ECOLI
[Raw transfer]




PLP_A_3(2EO5)
?
[Raw transfer]




PLP_B_7(4ZLV)
?
[Raw transfer]




PLP_A_7(1MLY)
BIOA_ECOLI
[Raw transfer]




PLP_C_7(2BYJ)
OAT_HUMAN
[Raw transfer]




PLP_B_6(2BYJ)
OAT_HUMAN
[Raw transfer]




PLP_B_6(2BYL)
OAT_HUMAN
[Raw transfer]




PLP_B_8(1DTY)
BIOA_ECOLI
[Raw transfer]




PLP_A_5(2BYL)
OAT_HUMAN
[Raw transfer]




PLP_A_4(1Z3Z)
DGDA_BURCE
[Raw transfer]




PLP_A_5(1OAT)
OAT_HUMAN
[Raw transfer]




PLP_C_7(2BYL)
OAT_HUMAN
[Raw transfer]




PLP_B_6(1OAT)
OAT_HUMAN
[Raw transfer]




PLP_A_3(2EO5)
?
[Raw transfer]




PLP_A_4(2DKB)
DGDA_BURCE
[Raw transfer]




PLP_A_7(1MLZ)
BIOA_ECOLI
[Raw transfer]




PLP_C_7(1OAT)
OAT_HUMAN
[Raw transfer]




PLP_A_5(1S07)
BIOA_ECOLI
[Raw transfer]




PLP_A_3(4JEY)
ARGD_SALTY
[Raw transfer]




PLP_B_4(1VEF)
ARGD_THET8
[Raw transfer]




PLP_B_6(1QJ5)
BIOA_ECOLI
[Raw transfer]




PLP_A_3(1VEF)
ARGD_THET8
[Raw transfer]




PLP_A_3(3DXV)
ACLR_ACHOB
[Raw transfer]




PLP_B_13(4JEY)
ARGD_SALTY
[Raw transfer]




PLP_A_3(4JF1)
ARGD_SALTY
[Raw transfer]




PLP_A_3(4JF1)
ARGD_SALTY
[Raw transfer]




PLP_A_3(2PB2)
ARGD_SALTY
[Raw transfer]




PLP_B_9(4JF1)
ARGD_SALTY
[Raw transfer]




PLP_A_7(1DTY)
BIOA_ECOLI
[Raw transfer]




PLP_A_3(2PB0)
ARGD_SALTY
[Raw transfer]




PLP_B_4(2PB0)
ARGD_SALTY
[Raw transfer]




PLP_B_6(1MGV)
BIOA_ECOLI
[Raw transfer]




PLP_A_5(1MGV)
BIOA_ECOLI
[Raw transfer]




PLP_A_4(1QJ5)
BIOA_ECOLI
[Raw transfer]




P00_A_3(4JEW)
ARGD_SALTY
[Raw transfer]




PLP_A_3(1QJ3)
BIOA_ECOLI
[Raw transfer]




P00_B_26(4JEX)
ARGD_SALTY
[Raw transfer]




PLP_B_6(1QJ3)
BIOA_ECOLI
[Raw transfer]




PEG_B_14(5EQC)
?
[Raw transfer]




PEG_A_6(5EQC)
?
[Raw transfer]




122 Fugue 97.0239%-127 * C6 *2OAT - OAT_HUMAN -
24 PsiBlast_CBE 95.8639%-123 - C6 -5EQC 2.9 ?
109 HHSearch 95.5840%-117 - C6 -2OAT 2.1 OAT_HUMAN
114 HHSearch 95.2839%-120 - C6 -4NOG 2.4 ?
7 PsiBlast_PDB 95.0139%-125 - C6 -5EAV - ? -
25 PsiBlast_CBE 94.9139%-122 - C6 -5EAV - ? -
8 PsiBlast_PDB 94.7439%-124 - C6 -5EQC 2.8 ?
28 PsiBlast_CBE 94.7139%-122 - C6 -4NOG 2.3 ?
5 PsiBlast_PDB 94.6939%-123 - C6 -4ZLV 3.5 ?
26 PsiBlast_CBE 94.2139%-120 - C6 -4ZWM 2.9 ?
6 PsiBlast_PDB 94.0339%-124 - C6 -4ZWM - ? -
9 PsiBlast_PDB 93.9539%-123 - C6 -4NOG 2.4 ?
27 PsiBlast_CBE 93.2539%-124 - C6 -4ZLV 3.5 ?
3 PsiBlast_PDB 92.2835%-130 - C6 -3NTJ - OAT_PLAF7 -
105 HHSearch 91.8334%-122 - C6 -1Z7D - OAT_PLAYO -
23 PsiBlast_CBE 91.7635%-129 - C6 -3NTJ - OAT_PLAF7 -
123 Fugue 91.5232%-121 - C6 -4UOX - PAT_ECOLI -
22 PsiBlast_CBE 91.3335%-128 - C6 -3NTJ - OAT_PLAF7 -
21 PsiBlast_CBE 91.3035%-128 - C6 -3NTJ - OAT_PLAF7 -
2 PsiBlast_PDB 90.6935%-130 - C6 -3LG0 - OAT_PLAFD -
10 PsiBlast_PDB 90.6440%-115 - C6 -2BYJ 3.7 OAT_HUMAN
31 PsiBlast_CBE 90.0740%-115 - C6 -2OAT 2.5 OAT_HUMAN
12 PsiBlast_PDB 90.0640%-115 - C6 -2OAT 2.1 OAT_HUMAN
40 PsiBlast_CBE 89.8440%-114 - C6 -2BYL 3.2 OAT_HUMAN
30 PsiBlast_CBE 89.7840%-114 - C6 -2BYJ 3.5 OAT_HUMAN
15 PsiBlast_PDB 89.7640%-111 - C6 -2BYL 3.4 OAT_HUMAN
32 PsiBlast_CBE 89.7040%-112 - C6 -2OAT 2.7 OAT_HUMAN
29 PsiBlast_CBE 89.4240%-115 - C6 -2BYJ 3.2 OAT_HUMAN
11 PsiBlast_PDB 89.2740%-116 - C6 -1OAT 3.7 OAT_HUMAN
39 PsiBlast_CBE 89.2240%-116 - C6 -2BYL 3.2 OAT_HUMAN
33 PsiBlast_CBE 88.9040%-115 - C6 -1OAT 3.7 OAT_HUMAN
34 PsiBlast_CBE 88.6440%-113 - C6 -1OAT 3.7 OAT_HUMAN
96 PsiBlast_CBE 87.4833%-121 - C6 -1D7U 2.6 DGDA_BURCE
97 PsiBlast_CBE 87.2733%-121 - C6 -1D7S 2.9 DGDA_BURCE
99 PsiBlast_CBE 86.8533%-122 - C6 -1Z3Z 3.0 DGDA_BURCE
95 PsiBlast_CBE 86.4033%-117 - C6 -1D7V 2.9 DGDA_BURCE
100 PsiBlast_CBE 85.8533%-125 - C6 -2DKB 3.5 DGDA_BURCE
107 HHSearch 83.7033%-124 - C6 -4JF1 2.9 ARGD_SALTY
121 HHSearch 83.1131%-132 - C6 -2EO5 3.4 ?
66 PsiBlast_CBE 83.0833%-129 - C6 -2PB0 2.9 ARGD_SALTY
117 HHSearch 82.7031%-112 - C6 -3DXV 2.5 ACLR_ACHOB
60 PsiBlast_CBE 82.1533%-127 - C6 -4JEY 2.6 ARGD_SALTY
67 PsiBlast_CBE 82.1133%-133 - C6 -2PB0 2.9 ARGD_SALTY
52 PsiBlast_CBE 82.0933%-128 - C6 -4JF1 2.8 ARGD_SALTY
61 PsiBlast_CBE 81.7333%-132 - C6 -4JEY 2.8 ARGD_SALTY
94 PsiBlast_CBE 81.2533%-117 - C6 -1MGV 3.0 BIOA_ECOLI
65 PsiBlast_CBE 81.0933%-133 - C6 -2PB2 2.7 ARGD_SALTY
56 PsiBlast_CBE 80.7133%-132 - C6 -4JEX 2.6 ARGD_SALTY
53 PsiBlast_CBE 80.2833%-130 - C6 -4JF1 2.9 ARGD_SALTY
71 PsiBlast_CBE 79.9333%-116 - C6 -1QJ5 3.3 BIOA_ECOLI
68 PsiBlast_CBE 79.8133%-118 - C6 -1S07 3.2 BIOA_ECOLI
74 PsiBlast_CBE 79.7733%-120 - C6 -1MLZ 3.1 BIOA_ECOLI
76 PsiBlast_CBE 79.7033%-117 - C6 -1MLY 2.5 BIOA_ECOLI
69 PsiBlast_CBE 79.6633%-115 - C6 -1S07 2.9 BIOA_ECOLI
78 PsiBlast_CBE 79.5833%-117 - C6 -1DTY 3.0 BIOA_ECOLI
75 PsiBlast_CBE 79.4833%-117 - C6 -1MLZ 2.5 BIOA_ECOLI
70 PsiBlast_CBE 79.4033%-117 - C6 -1QJ5 3.5 BIOA_ECOLI
73 PsiBlast_CBE 79.3333%-118 - C6 -1QJ3 3.5 BIOA_ECOLI
51 PsiBlast_CBE 79.3335%-114 - C6 -1VEF 3.2 ARGD_THET8
93 PsiBlast_CBE 79.3133%-117 - C6 -1MGV 3.1 BIOA_ECOLI
19 PsiBlast_PDB 79.3035%-112 - C6 -1VEF 3.1 ARGD_THET8
55 PsiBlast_CBE 79.0933%-131 - C6 -4JEW 2.8 ARGD_SALTY
77 PsiBlast_CBE 79.0733%-116 - C6 -1MLY 2.6 BIOA_ECOLI
79 PsiBlast_CBE 78.9733%-114 - C6 -1DTY 1.9 BIOA_ECOLI
72 PsiBlast_CBE 78.7033%-117 - C6 -1QJ3 3.4 BIOA_ECOLI
50 PsiBlast_CBE 78.7035%-113 - C6 -1WKG 2.3 ARGD_THET8
20 PsiBlast_PDB 78.4035%-112 - C6 -1WKG 2.3 ARGD_THET8
92 PsiBlast_CBE 72.8433%-116 - C6 -2EO5 3.4 ?