@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0019: (2015-12-18 )
MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPLTEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEKQHRQQA

Atome Classification :

(82 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BB2_A_3(1LRY)
DEF_PSEAE
[Raw transfer]




2BB_A_5(3K6L)
DEF_ECOLI
[Raw transfer]




BB2_A_2(3PN4)
DEF1B_ARATH
[Raw transfer]




GNR_B_6(1S17)
DEF_PSEAE
[Raw transfer]




BB2_A_5(1IX1)
DEF_PSEAE
[Raw transfer]




BB1_C_9(1G27)
DEF_ECOLI
[Raw transfer]




BB2_A_7(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_B_7(1IX1)
DEF_PSEAE
[Raw transfer]




2BB_B_7(3K6L)
DEF_ECOLI
[Raw transfer]




BB1_B_8(1G27)
DEF_ECOLI
[Raw transfer]




BB2_A_7(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_B_9(3M6P)
DEF1B_ARATH
[Raw transfer]




GNR_A_5(1S17)
DEF_PSEAE
[Raw transfer]




GOL_A_7(1N5N)
DEF_PSEAE
[Raw transfer]




BB2_A_3(4E9B)
?
[Raw transfer]




BB2_A_7(1G2A)
DEF_ECOLI
[Raw transfer]




BB1_A_7(1G27)
DEF_ECOLI
[Raw transfer]




GOL_A_7(1N5N)
DEF_PSEAE
[Raw transfer]




BB2_A_5(3U04)
?
[Raw transfer]




BB2_B_10(4DR9)
?
[Raw transfer]




BB2_B_10(1LRU)
DEF_ECOLI
[Raw transfer]




BB2_B_8(1G2A)
DEF_ECOLI
[Raw transfer]




GOL_B_6(1N5N)
DEF_PSEAE
[Raw transfer]




BB2_A_9(1LRU)
DEF_ECOLI
[Raw transfer]




BB2_D_17(4DR9)
?
[Raw transfer]




BB2_C_11(1LRU)
DEF_ECOLI
[Raw transfer]




BB2_C_14(4DR9)
?
[Raw transfer]




BB2_A_5(3U04)
?
[Raw transfer]




BB2_A_7(4DR9)
?
[Raw transfer]




BB2_C_9(1G2A)
DEF_ECOLI
[Raw transfer]




FMT_A_3(1XEN)
DEF_ECOLI
[Raw transfer]




FMT_A_3(1XEO)
DEF_ECOLI
[Raw transfer]




FMT_A_3(1XEO)
DEF_ECOLI
[Raw transfer]




BB2_A_5(3UWB)
?
[Raw transfer]




SB7_A_7(2AI8)
DEF_ECOLI
[Raw transfer]




FMT_A_3(1XEM)
DEF_ECOLI
[Raw transfer]




SB7_B_8(2AI8)
DEF_ECOLI
[Raw transfer]




NVC_A_3(3E3U)
DEF_MYCTU
[Raw transfer]




SB7_C_9(2AI8)
DEF_ECOLI
[Raw transfer]




FMT_A_13(1Y6H)
DEF_LEPIN
[Raw transfer]




MLN_A_4(1BSK)
DEF_ECOLI
[Raw transfer]




FMT_A_3(2W3U)
DEF_ECOLI
[Raw transfer]




MLN_A_4(1BSJ)
DEF_ECOLI
[Raw transfer]




FMT_A_13(1Y6H)
DEF_LEPIN
[Raw transfer]




FMT_B_6(1Y6H)
DEF_LEPIN
[Raw transfer]




Y13_A_3(2EW6)
?
[Raw transfer]




2PE_C_11(1BS4)
DEF_ECOLI
[Raw transfer]




EPE_B_6(1VEY)
DEF_LEPIN
[Raw transfer]




FMT_B_18(1VEZ)
DEF_LEPIN
[Raw transfer]




FMT_A_12(1VEZ)
DEF_LEPIN
[Raw transfer]




BRR_B_7(1RL4)
?
[Raw transfer]




FMT_A_6(1XEN)
DEF_ECOLI
[Raw transfer]




QAP_A_3(4E9A)
?
[Raw transfer]




2PE_B_10(1BSZ)
DEF_ECOLI
[Raw transfer]




2PE_A_9(1BSZ)
DEF_ECOLI
[Raw transfer]




BRR_A_5(1RL4)
?
[Raw transfer]




BRR_A_5(1RL4)
?
[Raw transfer]




2PE_A_9(1BS4)
DEF_ECOLI
[Raw transfer]




2PE_A_9(1BS4)
DEF_ECOLI
[Raw transfer]




2PE_C_11(1BSZ)
DEF_ECOLI
[Raw transfer]




Y12_A_3(2EW5)
?
[Raw transfer]




2PE_C_11(1ICJ)
DEF_ECOLI
[Raw transfer]




2PE_A_9(1ICJ)
DEF_ECOLI
[Raw transfer]




MES_B_6(1VEV)
DEF_LEPIN
[Raw transfer]




2PE_B_10(1ICJ)
DEF_ECOLI
[Raw transfer]




BB4_A_8(3O3J)
DEF1B_ARATH
[Raw transfer]




EPE_A_5(1VEY)
DEF_LEPIN
[Raw transfer]




MES_A_5(1VEV)
DEF_LEPIN
[Raw transfer]




2PE_B_10(1BS4)
DEF_ECOLI
[Raw transfer]




EOH_A_4(2W3T)
DEF_ECOLI
[Raw transfer]




EOH_A_4(2W3T)
DEF_ECOLI
[Raw transfer]




CHAIN_F_6(1BS6)
DEF_ECOLI
[Raw transfer]

-

H2S_A_3(4AZ4)
?
[Raw transfer]




CHAIN_D_4(1BS8)
DEF_ECOLI
[Raw transfer]

-

H2S_A_5(4AL2)
DEF_ECOLI
[Raw transfer]




CHAIN_E_5(1BS8)
DEF_ECOLI
[Raw transfer]

-

H2S_B_7(4AL2)
DEF_ECOLI
[Raw transfer]




CHAIN_D_4(1BS6)
DEF_ECOLI
[Raw transfer]

-

H2S_C_9(4AL2)
DEF_ECOLI
[Raw transfer]




CHAIN_E_5(1BS6)
DEF_ECOLI
[Raw transfer]

-

CHAIN_F_6(1BS8)
DEF_ECOLI
[Raw transfer]

-

DTT_B_6(1SV2)
DEF_LEPIN
[Raw transfer]




21 PsiBlast_CBE 97.53100% -93 - C5 -1IX1 7.0 DEF_PSEAE
3 PsiBlast_PDB 97.0999% -95 - C5 -1S17 4.5 DEF_PSEAE
4 PsiBlast_PDB 96.82100%-100 - C5 -1LRY 7.1 DEF_PSEAE
23 PsiBlast_CBE 96.7099% -96 - C5 -1N5N 2.1 DEF_PSEAE
1 PsiBlast_PDB 96.60100% -94 - C5 -1IX1 7.0 DEF_PSEAE
101 HHSearch 96.4499% -95 - C5 -1N5N 2.6 DEF_PSEAE
2 PsiBlast_PDB 96.4499% -95 - C5 -1N5N 2.6 DEF_PSEAE
22 PsiBlast_CBE 96.3699%-100 - C5 -1S17 4.7 DEF_PSEAE
43 PsiBlast_CBE 85.4756% -89 - C5 -1BSZ 4.9 DEF_ECOLI
53 PsiBlast_CBE 85.1856% -91 - C5 -1BS4 4.8 DEF_ECOLI
52 PsiBlast_CBE 85.0956% -92 - C5 -1BS4 5.4 DEF_ECOLI
37 PsiBlast_CBE 84.9456% -90 - C5 -1ICJ 4.1 DEF_ECOLI
50 PsiBlast_CBE 84.6456% -91 - C5 -1BS5 - DEF_ECOLI -
36 PsiBlast_CBE 84.6256% -90 - C5 -1ICJ 5.4 DEF_ECOLI
27 PsiBlast_CBE 84.6056% -94 - C5 -4AL2 2.8 DEF_ECOLI
7 PsiBlast_PDB 84.6056% -90 - C5 -2W3T 2.4 DEF_ECOLI
25 PsiBlast_CBE 84.5456% -94 - C5 -3K6L 5.2 DEF_ECOLI
105 HHSearch 84.4657% -91 - C5 -2W3T 2.4 DEF_ECOLI
45 PsiBlast_CBE 84.4556% -89 - C5 -1BS8 4.2 DEF_ECOLI
49 PsiBlast_CBE 84.4456% -87 - C5 -1BS6 4.2 DEF_ECOLI
12 PsiBlast_PDB 84.4456% -95 - C5 -1BS6 3.9 DEF_ECOLI
42 PsiBlast_CBE 84.3956% -88 - C5 -1BSZ 4.5 DEF_ECOLI
19 PsiBlast_PDB 84.2456% -90 - C5 -1G2A 6.2 DEF_ECOLI
5 PsiBlast_PDB 84.2456% -96 - C5 -3K6L 5.8 DEF_ECOLI
14 PsiBlast_PDB 84.2056% -90 - C5 -1BS8 4.0 DEF_ECOLI
32 PsiBlast_CBE 84.1956% -90 - C5 -1XEN 3.5 DEF_ECOLI
17 PsiBlast_PDB 84.1856% -90 - C5 -1BSK 6.8 DEF_ECOLI
44 PsiBlast_CBE 84.1656% -92 - C5 -1BS8 3.8 DEF_ECOLI
126 Fugue 84.1456% -84 - C5 -1BS4 5.6 DEF_ECOLI
26 PsiBlast_CBE 84.1356% -97 - C5 -4AL2 2.8 DEF_ECOLI
28 PsiBlast_CBE 84.1156% -88 - C5 -2AI8 4.1 DEF_ECOLI
8 PsiBlast_PDB 84.1156% -86 - C5 -2W3U 3.4 DEF_ECOLI
16 PsiBlast_PDB 84.1056% -88 - C5 -1BSJ 6.7 DEF_ECOLI
6 PsiBlast_PDB 84.1056% -99 - C5 -4AL2 2.8 DEF_ECOLI
9 PsiBlast_PDB 84.0956% -88 - C5 -1ICJ 5.7 DEF_ECOLI
41 PsiBlast_CBE 84.0756% -93 - C5 -1G27 5.0 DEF_ECOLI
15 PsiBlast_PDB 84.0656% -88 - C5 -1BSZ 5.5 DEF_ECOLI
34 PsiBlast_CBE 84.0356% -99 - C5 -1LRU 5.8 DEF_ECOLI
30 PsiBlast_CBE 84.0356% -87 - C5 -2AI8 4.2 DEF_ECOLI
10 PsiBlast_PDB 83.9556% -88 - C5 -1BS4 5.6 DEF_ECOLI
102 HHSearch 83.8457% -86 - C5 -1XEO 3.5 DEF_ECOLI
31 PsiBlast_CBE 83.8256% -89 - C5 -1XEO 3.5 DEF_ECOLI
33 PsiBlast_CBE 83.7756% -90 - C5 -1XEM 3.6 DEF_ECOLI
125 Fugue 83.7156% -88 - C5 -1G2A 6.2 DEF_ECOLI
35 PsiBlast_CBE 83.6656% -89 - C5 -1LRU 7.2 DEF_ECOLI
39 PsiBlast_CBE 83.6356% -92 - C5 -1G2A 6.8 DEF_ECOLI
38 PsiBlast_CBE 83.5256% -90 - C5 -1G2A 7.1 DEF_ECOLI
18 PsiBlast_PDB 83.5256% -92 - C5 -1G27 5.9 DEF_ECOLI
48 PsiBlast_CBE 83.4556% -90 - C5 -1BS6 4.0 DEF_ECOLI
55 PsiBlast_CBE 83.3655% -90 - C5 -4AZ4 2.9 ?
29 PsiBlast_CBE 83.1956% -90 - C5 -2AI8 4.0 DEF_ECOLI
20 PsiBlast_PDB 82.8256% -89 - C5 -1LRU 6.3 DEF_ECOLI
40 PsiBlast_CBE 82.7756% -90 - C5 -1G27 5.1 DEF_ECOLI
58 PsiBlast_CBE 80.9743% -97 - C5 -3U04 7.0 ?
104 HHSearch 80.6646% -91 - C5 -3U04 7.0 ?
72 PsiBlast_CBE 78.6447% -96 - C5 -2EW6 6.7 ?
73 PsiBlast_CBE 77.7047% -96 - C5 -2EW5 7.4 ?
70 PsiBlast_CBE 77.7047% -98 - C5 -4E9A 6.9 ?
69 PsiBlast_CBE 77.6147% -99 - C5 -4E9B 7.2 ?
124 Fugue 77.0750% -74 - C5 -1G2A 6.2 DEF_ECOLI
95 PsiBlast_CBE 74.9337% -90 - C5 -3PN4 6.8 DEF1B_ARATH
100 PsiBlast_CBE 74.8737% -92 - C5 -3M6P 6.7 DEF1B_ARATH
64 PsiBlast_CBE 74.3850%-106 - C5 -4DR9 7.0 ?
62 PsiBlast_CBE 74.2550%-102 - C5 -4DR9 6.9 ?
63 PsiBlast_CBE 73.6650%-102 - C5 -4DR9 6.9 ?
114 HHSearch 73.4437% -67 - C5 -3E3U 6.1 DEF_MYCTU
112 HHSearch 73.3037% -92 - C5 -1RL4 4.2 ?
61 PsiBlast_CBE 73.2950% -98 - C5 -4DR9 7.3 ?
99 PsiBlast_CBE 73.1237% -84 - C5 -3O3J 4.2 DEF1B_ARATH
92 PsiBlast_CBE 72.7639% -97 - C5 -1RL4 4.2 ?
93 PsiBlast_CBE 72.4739% -96 - C5 -1RL4 4.2 ?
75 PsiBlast_CBE 72.1840% -95 - C5 -1Y6H 3.4 DEF_LEPIN
108 HHSearch 72.1042% -88 - C5 -1Y6H 3.4 DEF_LEPIN
82 PsiBlast_CBE 71.8240% -81 - C5 -1SV2 1.6 DEF_LEPIN
77 PsiBlast_CBE 71.5540% -81 - C5 -1VEZ 3.2 DEF_LEPIN
78 PsiBlast_CBE 71.5440% -85 - C5 -1VEY 3.4 DEF_LEPIN
79 PsiBlast_CBE 71.4540% -84 - C5 -1VEY 2.9 DEF_LEPIN
80 PsiBlast_CBE 71.3240% -86 - C5 -1VEV 2.3 DEF_LEPIN
76 PsiBlast_CBE 71.2440% -83 - C5 -1VEZ 3.2 DEF_LEPIN
81 PsiBlast_CBE 71.0740% -90 - C5 -1VEV 3.0 DEF_LEPIN
74 PsiBlast_CBE 71.0340% -86 - C5 -1Y6H 3.5 DEF_LEPIN
106 HHSearch 70.5936% -86 - C5 -3UWB 5.6 ?