@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2052: (2016-03-31 )
MGDKIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSKKPLFTIEERMEMIRQVTAHLPNVQVESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIASMNRTLNADIETFFVMTNTKYSFLSSSMVKEVAQYQGDISELVPEIVNKAVQAKFK

Atome Classification :

(71 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

COA_B_11(3OTW)
COAD_HELPY
[Raw transfer]




COA_A_2(3L92)
COAD_YERPE
[Raw transfer]




COA_E_18(3OTW)
COAD_HELPY
[Raw transfer]




COD_A_2(3PXU)
COAD_BURP1
[Raw transfer]




COA_A_8(3OTW)
COAD_HELPY
[Raw transfer]




COD_J_10(1B6T)
COAD_ECOLI
[Raw transfer]




COD_A_2(3RBA)
COAD_MYCTU
[Raw transfer]




COA_D_15(3OTW)
COAD_HELPY
[Raw transfer]




COA_F_19(3OTW)
COAD_HELPY
[Raw transfer]




COA_C_13(3OTW)
COAD_HELPY
[Raw transfer]




4PS_A_2(3K9W)
COAD_BURP1
[Raw transfer]




4PS_A_2(3K9W)
COAD_BURP1
[Raw transfer]




ATP_A_4(1GN8)
COAD_ECOLI
[Raw transfer]




ATP_B_6(1GN8)
COAD_ECOLI
[Raw transfer]




AGS_B_6(4NAU)
COAD_STAAW
[Raw transfer]




COA_C_7(3PNB)
COAD_MYCTU
[Raw transfer]




ATP_F_12(3ND6)
COAD_ENTFA
[Raw transfer]




ATP_A_2(3UC5)
COAD_MYCTU
[Raw transfer]




AGS_C_7(4NAU)
COAD_STAAW
[Raw transfer]




APC_B_6(3NBA)
COAD_MYCTU
[Raw transfer]




PNS_C_9(1VLH)
COAD_THEMA
[Raw transfer]




COA_B_6(3PNB)
COAD_MYCTU
[Raw transfer]




COA_D_8(3PNB)
COAD_MYCTU
[Raw transfer]




APC_D_9(3NBA)
COAD_MYCTU
[Raw transfer]




APC_C_8(3NBA)
COAD_MYCTU
[Raw transfer]




PNS_D_10(1VLH)
COAD_THEMA
[Raw transfer]




PNS_A_7(1VLH)
COAD_THEMA
[Raw transfer]




ATP_A_7(3ND6)
COAD_ENTFA
[Raw transfer]




PNS_A_7(1VLH)
COAD_THEMA
[Raw transfer]




APC_A_5(3NBA)
COAD_MYCTU
[Raw transfer]




PPS_A_2(3F3M)
COAD_STAAW
[Raw transfer]




COA_A_5(3PNB)
COAD_MYCTU
[Raw transfer]




COA_A_7(1H1T)
COAD_ECOLI
[Raw transfer]




ADP_A_5(1O6B)
COAD_BACSU
[Raw transfer]




PNS_B_22(1QJC)
COAD_ECOLI
[Raw transfer]




ATP_E_11(3ND6)
COAD_ENTFA
[Raw transfer]




PNS_B_8(1H1T)
COAD_ECOLI
[Raw transfer]




ADP_A_5(1O6B)
COAD_BACSU
[Raw transfer]




GOL_A_2(4E1A)
COAD_MYCTU
[Raw transfer]




PNS_E_11(1VLH)
COAD_THEMA
[Raw transfer]




ADP_C_11(4NAT)
COAD_STAAW
[Raw transfer]




PNS_A_2(1OD6)
COAD_THET8
[Raw transfer]




PNS_A_2(1OD6)
COAD_THET8
[Raw transfer]




PNS_B_8(1VLH)
COAD_THEMA
[Raw transfer]




PNS_F_12(1VLH)
COAD_THEMA
[Raw transfer]




PNS_A_5(3NBK)
COAD_MYCTU
[Raw transfer]




PNS_A_5(3NBK)
COAD_MYCTU
[Raw transfer]




ADP_B_9(4NAT)
COAD_STAAW
[Raw transfer]




COA_A_2(3LCJ)
COAD_MYCTU
[Raw transfer]




PNS_D_10(3NBK)
COAD_MYCTU
[Raw transfer]




2VJ_A_9(4NAH)
COAD_STAAW
[Raw transfer]




PNS_B_7(3NBK)
COAD_MYCTU
[Raw transfer]




ADP_A_6(4NAT)
COAD_STAAW
[Raw transfer]




PNY_C_9(3ND7)
COAD_ENTFA
[Raw transfer]




COA_A_2(3RHS)
COAD_MYCTU
[Raw transfer]




PNY_A_7(3ND7)
COAD_ENTFA
[Raw transfer]




PNS_C_8(3NBK)
COAD_MYCTU
[Raw transfer]




2W3_A_5(4NAU)
COAD_STAAW
[Raw transfer]




PNY_D_10(3ND7)
COAD_ENTFA
[Raw transfer]




FMT_A_2(3L93)
COAD_YERPE
[Raw transfer]




PNY_F_12(3ND7)
COAD_ENTFA
[Raw transfer]




2VJ_D_14(4NAH)
COAD_STAAW
[Raw transfer]




2W5_B_7(4NAT)
COAD_STAAW
[Raw transfer]




PNY_B_8(3ND7)
COAD_ENTFA
[Raw transfer]




PNY_E_11(3ND7)
COAD_ENTFA
[Raw transfer]




2VJ_B_11(4NAH)
COAD_STAAW
[Raw transfer]




2VJ_F_18(4NAH)
COAD_STAAW
[Raw transfer]




2W5_A_4(4NAT)
COAD_STAAW
[Raw transfer]




2VJ_F_17(4NAH)
COAD_STAAW
[Raw transfer]




2VJ_A_8(4NAH)
COAD_STAAW
[Raw transfer]




ACY_A_6(3NV7)
COAD_HELPY
[Raw transfer]




ACY_A_6(3NV7)
COAD_HELPY
[Raw transfer]




98 HHSearch 92.3163%-131 - C1 -1O6B 6.6 COAD_BACSU
1 PsiBlast_PDB 90.9762%-134 - C1 -1O6B 6.6 COAD_BACSU
29 PsiBlast_CBE 86.7760%-121 - C1 -4NAH 7.1 COAD_STAAW
25 PsiBlast_CBE 86.6460%-123 - C1 -4NAH 7.6 COAD_STAAW
28 PsiBlast_CBE 86.3660%-119 - C1 -4NAH 6.9 COAD_STAAW
2 PsiBlast_PDB 85.9260%-125 - C1 -4NAH 7.9 COAD_STAAW
26 PsiBlast_CBE 85.9060%-119 - C1 -4NAH 6.9 COAD_STAAW
4 PsiBlast_PDB 85.8660%-124 - C1 -4NAU 6.7 COAD_STAAW
21 PsiBlast_CBE 85.5760%-120 - C1 -4NAU 6.5 COAD_STAAW
96 HHSearch 85.3849%-126 - C1 -3NBK 3.4 COAD_MYCTU
22 PsiBlast_CBE 85.2860%-118 - C1 -4NAU 6.9 COAD_STAAW
12 PsiBlast_PDB 85.2250%-131 - C1 -3NBK 3.4 COAD_MYCTU
38 PsiBlast_CBE 85.0050%-133 - C1 -3NBK 3.4 COAD_MYCTU
27 PsiBlast_CBE 84.9760%-122 - C1 -4NAH 7.2 COAD_STAAW
47 PsiBlast_CBE 84.6750%-126 - C1 -4R0N - COAD_MYCTU -
35 PsiBlast_CBE 84.6250%-129 - C1 -3PNB 5.5 COAD_MYCTU
5 PsiBlast_PDB 84.5560%-122 - C1 -3F3M 5.6 COAD_STAAW
31 PsiBlast_CBE 84.3651%-124 - C1 -1H1T 3.7 COAD_ECOLI
10 PsiBlast_PDB 84.0551%-120 - C1 -1H1T 5.3 COAD_ECOLI
13 PsiBlast_PDB 83.9250%-133 - C1 -3PNB 5.1 COAD_MYCTU
37 PsiBlast_CBE 83.8050%-130 - C1 -3NBK 3.3 COAD_MYCTU
24 PsiBlast_CBE 83.7460%-119 - C1 -4NAT 6.4 COAD_STAAW
33 PsiBlast_CBE 83.6151%-118 - C1 -1B6T 6.7 COAD_ECOLI
36 PsiBlast_CBE 83.3150%-134 - C1 -3PNB 5.2 COAD_MYCTU
39 PsiBlast_CBE 83.2450%-133 - C1 -3NBK 3.4 COAD_MYCTU
51 PsiBlast_CBE 83.2052%-129 - C1 -1VLH 4.6 COAD_THEMA
23 PsiBlast_CBE 82.9460%-124 - C1 -4NAT 4.2 COAD_STAAW
20 PsiBlast_PDB 82.9250%-129 - C1 -4E1A 3.1 COAD_MYCTU
56 PsiBlast_CBE 82.8452%-127 - C1 -1VLH 5.5 COAD_THEMA
17 PsiBlast_PDB 82.6950%-130 - C1 -3RHS 3.0 COAD_MYCTU
93 HHSearch 82.5951%-126 - C1 -1VLH 5.5 COAD_THEMA
54 PsiBlast_CBE 82.5452%-131 - C1 -1VLH 5.5 COAD_THEMA
55 PsiBlast_CBE 82.4752%-129 - C1 -1VLH 4.5 COAD_THEMA
52 PsiBlast_CBE 82.4552%-130 - C1 -1VLH 5.6 COAD_THEMA
92 HHSearch 82.4454%-130 - C1 -1OD6 3.6 COAD_THET8
34 PsiBlast_CBE 82.4250%-129 - C1 -3PNB 4.6 COAD_MYCTU
30 PsiBlast_CBE 82.3651%-115 - C1 -1QJC 4.5 COAD_ECOLI
19 PsiBlast_PDB 82.2950%-132 - C1 -3LCJ 3.9 COAD_MYCTU
9 PsiBlast_PDB 82.1351%-117 - C1 -1GN8 6.6 COAD_ECOLI
6 PsiBlast_PDB 82.0754%-135 - C1 -1OD6 3.6 COAD_THET8
3 PsiBlast_PDB 82.0460%-128 - C1 -4NAT 5.2 COAD_STAAW
32 PsiBlast_CBE 81.9351%-118 - C1 -1GN8 6.1 COAD_ECOLI
53 PsiBlast_CBE 81.9252%-129 - C1 -1VLH 5.7 COAD_THEMA
42 PsiBlast_CBE 81.4550%-124 - C1 -3NBA 7.2 COAD_MYCTU
97 HHSearch 81.2147%-124 - C1 -3K9W 3.4 COAD_BURP1
18 PsiBlast_PDB 80.9550%-128 - C1 -3UC5 6.8 COAD_MYCTU
41 PsiBlast_CBE 80.8650%-128 - C1 -3NBA 6.7 COAD_MYCTU
15 PsiBlast_PDB 80.4950%-128 - C1 -3RBA 7.7 COAD_MYCTU
40 PsiBlast_CBE 80.3750%-129 - C1 -3NBA 6.6 COAD_MYCTU
58 PsiBlast_CBE 80.1348%-127 - C1 -3K9W 3.4 COAD_BURP1
49 PsiBlast_CBE 78.7550%-121 - C1 -3L93 2.9 COAD_YERPE
50 PsiBlast_CBE 78.6350%-123 - C1 -3L92 5.4 COAD_YERPE
57 PsiBlast_CBE 78.4348%-132 - C1 -3PXU 6.7 COAD_BURP1
11 PsiBlast_PDB 77.4250%-128 - C1 -3NBA 6.5 COAD_MYCTU
72 PsiBlast_CBE 75.1043%-122 - C1 -3OTW 7.3 COAD_HELPY
76 PsiBlast_CBE 75.0843%-123 - C1 -3OTW 7.9 COAD_HELPY
63 PsiBlast_CBE 74.9245%-132 - C1 -3ND7 3.1 COAD_ENTFA
70 PsiBlast_CBE 74.8845%-131 - C1 -3ND6 5.8 COAD_ENTFA
61 PsiBlast_CBE 74.7845%-133 - C1 -3ND7 3.3 COAD_ENTFA
60 PsiBlast_CBE 74.6045%-134 - C1 -3ND7 3.2 COAD_ENTFA
64 PsiBlast_CBE 74.5245%-130 - C1 -3ND7 2.5 COAD_ENTFA
75 PsiBlast_CBE 74.4043%-123 - C1 -3OTW 5.6 COAD_HELPY
71 PsiBlast_CBE 74.2943%-121 - C1 -3OTW 5.1 COAD_HELPY
59 PsiBlast_CBE 73.7745%-134 - C1 -3ND7 3.2 COAD_ENTFA
66 PsiBlast_CBE 73.4645%-129 - C1 -3ND6 5.5 COAD_ENTFA
65 PsiBlast_CBE 73.3345%-130 - C1 -3ND6 5.1 COAD_ENTFA
73 PsiBlast_CBE 73.2743%-124 - C1 -3OTW 5.5 COAD_HELPY
62 PsiBlast_CBE 72.9945%-129 - C1 -3ND7 3.0 COAD_ENTFA
74 PsiBlast_CBE 72.6643%-120 - C1 -3OTW 6.8 COAD_HELPY
77 PsiBlast_CBE 68.6943%-139 - C1 -3NV7 3.5 COAD_HELPY
99 HHSearch 66.1140%-134 - C1 -3NV7 3.5 COAD_HELPY