@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv0009: (2016-04-18 )
MADCDSVTNSPLATATATLHTNRGDIKIALFGNHAPKTVANFVGLAQGTKDYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADEFHPELQFDKPYLLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVIDAESQRVVEAISKTATDGNDRPTDPVVIESITIS

Atome Classification :

(99 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

WM1_A_4(4N1P)
PPIA_HUMAN
[Raw transfer]




EA4_A_2(3RDD)
PPIA_HUMAN
[Raw transfer]




WM3_A_2(4N1R)
PPIA_HUMAN
[Raw transfer]




WM4_A_2(4N1S)
PPIA_HUMAN
[Raw transfer]




LSA_A_3(4N1O)
PPIA_HUMAN
[Raw transfer]




WM1_A_2(4N1P)
PPIA_HUMAN
[Raw transfer]




EDO_A_4(4R3F)
?
[Raw transfer]




UNU_A_2(4N1N)
PPIA_HUMAN
[Raw transfer]




WM2_A_2(4N1Q)
PPIA_HUMAN
[Raw transfer]




GOL_D_4(2HQ6)
CWC27_HUMAN
[Raw transfer]




EDO_A_4(4R3F)
?
[Raw transfer]




GOL_D_4(2HQ6)
CWC27_HUMAN
[Raw transfer]




GOL_A_3(4R3E)
CWC27_HUMAN
[Raw transfer]




GOL_C_4(2A2N)

[Raw transfer]




FMT_D_4(2POE)
?
[Raw transfer]




PRO_A_3(4N1M)
PPIA_HUMAN
[Raw transfer]




PRO_A_3(2CFE)
?
[Raw transfer]




EDO_A_2(3S6M)
?
[Raw transfer]




FMT_D_4(2POE)
?
[Raw transfer]




GOL_A_4(4R3E)
CWC27_HUMAN
[Raw transfer]




CHAIN_H_8(2RMC)
PPIC_MOUSE
[Raw transfer]

-

EOV_B_4(3EOV)
?
[Raw transfer]

-

EOV_A_3(3EOV)
?
[Raw transfer]

-

GLY_A_2(4N1M)
PPIA_HUMAN
[Raw transfer]




DTT_A_2(1H0P)
CYP5_CAEEL
[Raw transfer]




ALA_A_2(2CFE)
?
[Raw transfer]




ALA_B_3(2QER)
?
[Raw transfer]




WM1_A_3(4N1P)
PPIA_HUMAN
[Raw transfer]




CHAIN_B_2(1LOP)
PPIB_ECOLI
[Raw transfer]

-

CHAIN_R_18(2RMB)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_T_20(2RMB)
PPIA_HUMAN
[Raw transfer]

-

WM4_A_3(4N1S)
PPIA_HUMAN
[Raw transfer]




CHAIN_P_16(2RMB)
PPIA_HUMAN
[Raw transfer]

-

PG5_A_5(3K2C)
CYPH_ENCCU
[Raw transfer]




CHAIN_N_14(2RMB)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_E_5(1XQ7)
?
[Raw transfer]

-

CHAIN_L_12(2RMB)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_D_4(1XQ7)
?
[Raw transfer]

-

CHAIN_U_5(2POY)
?
[Raw transfer]

-

CHAIN_V_6(2POY)
?
[Raw transfer]

-

CHAIN_L_10(2ESL)
PPIC_HUMAN
[Raw transfer]

-

PG5_B_7(3K2C)
CYPH_ENCCU
[Raw transfer]




CHAIN_M_11(2ESL)
PPIC_HUMAN
[Raw transfer]

-

CHAIN_J_10(1C5F)
CYP1_BRUMA
[Raw transfer]

-

CHAIN_D_4(1C5F)
CYP1_BRUMA
[Raw transfer]

-

CHAIN_F_6(1C5F)
CYP1_BRUMA
[Raw transfer]

-

CHAIN_N_14(1C5F)
CYP1_BRUMA
[Raw transfer]

-

CHAIN_N_12(2ESL)
PPIC_HUMAN
[Raw transfer]

-

CHAIN_F_4(4JJM)
?
[Raw transfer]

-

CHAIN_F_6(2RMC)
PPIC_MOUSE
[Raw transfer]

-

CHAIN_B_2(2X7K)
PPIL1_HUMAN
[Raw transfer]

-

CHAIN_F_6(1XQ7)
?
[Raw transfer]

-

CHAIN_N_14(1C5F)
CYP1_BRUMA
[Raw transfer]

-

CHAIN_D_4(2OJU)
PPIL3_HUMAN
[Raw transfer]

-

CHAIN_B_2(2X7K)
PPIL1_HUMAN
[Raw transfer]

-

CHAIN_C_3(2OJU)
PPIL3_HUMAN
[Raw transfer]

-

CHAIN_R_18(2RMB)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_P_16(1C5F)
CYP1_BRUMA
[Raw transfer]

-

CHAIN_P_16(1C5F)
CYP1_BRUMA
[Raw transfer]

-

CHAIN_T_4(2POY)
?
[Raw transfer]

-

CHAIN_B_2(1C5F)
CYP1_BRUMA
[Raw transfer]

-

CHAIN_B_2(2RMC)
PPIC_MOUSE
[Raw transfer]

-

CHAIN_D_4(2RMC)
PPIC_MOUSE
[Raw transfer]

-

CHAIN_M_11(2ESL)
PPIC_HUMAN
[Raw transfer]

-

CHAIN_T_20(2RMB)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_B_2(2RMC)
PPIC_MOUSE
[Raw transfer]

-

CHAIN_B_2(3CYS)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_N_12(2ESL)
PPIC_HUMAN
[Raw transfer]

-

CHAIN_C_2(1CYN)
PPIB_HUMAN
[Raw transfer]

-

CHAIN_L_10(2ESL)
PPIC_HUMAN
[Raw transfer]

-

CHAIN_E_3(4JJM)
?
[Raw transfer]

-

CHAIN_R_18(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_E_5(3BO7)
?
[Raw transfer]

-

CHAIN_B_2(2WFJ)
PPIG_HUMAN
[Raw transfer]

-

CHAIN_P_16(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_L_12(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_R_18(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_N_14(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_T_20(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_P_16(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_P_16(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_N_14(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_T_20(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_L_12(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_N_14(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_L_12(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_R_18(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_N_14(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_T_20(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_P_16(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_L_12(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_B_2(4IPZ)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_T_20(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_R_18(3ODI)
PPIA_HUMAN
[Raw transfer]

-

103 HHSearch 96.74100%-104 - C6 -1W74 - PPIA_MYCTU -
1 PsiBlast_PDB 96.74100%-104 - C6 -1W74 - PPIA_MYCTU -
113 HHSearch 78.1051%-106 - C6 -2A2N - PPWD1_HUMAN -
57 PsiBlast_CBE 77.8639%-109 - C6 -1ZKC - PPIL2_HUMAN -
56 PsiBlast_CBE 77.2639%-105 - C6 -1ZKC - -
15 PsiBlast_PDB 77.2136% -95 - C6 -4R3F 2.3 ?
117 HHSearch 76.6450%-103 - C6 -2OK3 - PPIL3_HUMAN -
108 HHSearch 76.3644%-110 - C6 -2FU0 - ? -
104 HHSearch 76.0849%-107 - C6 -2X7K 7.4 PPIL1_HUMAN
111 HHSearch 75.8443%-100 - C6 -1ZKC - PPIL2_HUMAN -
112 HHSearch 75.4945% -92 - C6 -4R3F 2.3 ?
114 HHSearch 75.3138%-107 - C6 -3BKP - ? -
110 HHSearch 75.1943% -97 - C6 -2B71 - ? -
109 HHSearch 75.0843%-104 - C6 -2POE 2.6 ?
4 PsiBlast_PDB 74.7646%-103 - C6 -2A2N - PPWD1_HUMAN -
21 PsiBlast_CBE 74.7446%-101 - C6 -2A2N 2.9
22 PsiBlast_CBE 73.5344%-107 - C6 -2OJU 7.0 PPIL3_HUMAN
115 HHSearch 73.0435%-106 - C6 -3BO7 5.2 ?
51 PsiBlast_CBE 72.6842% -90 - C6 -2WFJ 7.3 PPIG_HUMAN
13 PsiBlast_PDB 72.4341%-104 - C6 -2QER 2.7 ?
7 PsiBlast_PDB 72.0146%-108 - C6 -2X7K 7.4 PPIL1_HUMAN
10 PsiBlast_PDB 71.8540% -92 - C6 -4R3E 2.6 CWC27_HUMAN
26 PsiBlast_CBE 71.7746% -95 - C6 -2ESL 7.4 PPIC_HUMAN
5 PsiBlast_PDB 71.6444%-100 - C6 -2OJU 7.1 PPIL3_HUMAN
12 PsiBlast_PDB 71.3241%-100 - C6 -2POE 2.6 ?
11 PsiBlast_PDB 71.2340% -90 - C6 -2HQ6 2.3 CWC27_HUMAN
107 HHSearch 71.1844% -91 - C6 -2HQ6 2.3 CWC27_HUMAN
29 PsiBlast_CBE 71.0946% -94 - C6 -2ESL 2.5 PPIC_HUMAN
45 PsiBlast_CBE 70.9745% -84 - C6 -2POY 7.3 ?
43 PsiBlast_CBE 70.9545% -87 - C6 -2POY 6.7 ?
34 PsiBlast_CBE 69.7745% -89 - C6 -1C5F 7.2 CYP1_BRUMA
27 PsiBlast_CBE 69.7046% -93 - C6 -2ESL 7.3 PPIC_HUMAN
30 PsiBlast_CBE 69.5746% -93 - C6 -2ESL 2.3 PPIC_HUMAN
17 PsiBlast_PDB 69.5046% -91 - C6 -2ESL 2.5 PPIC_HUMAN
36 PsiBlast_CBE 69.4645% -84 - C6 -1C5F 6.5 CYP1_BRUMA
39 PsiBlast_CBE 69.3645% -86 - C6 -1C5F 7.0 CYP1_BRUMA
44 PsiBlast_CBE 68.9545% -81 - C6 -2POY 7.6 ?
33 PsiBlast_CBE 68.9545% -82 - C6 -1C5F 6.7 CYP1_BRUMA
28 PsiBlast_CBE 68.6546% -89 - C6 -2ESL 6.9 PPIC_HUMAN
41 PsiBlast_CBE 68.3645% -94 - C6 -2CFE 3.4 ?
35 PsiBlast_CBE 68.3145% -84 - C6 -1C5F 2.8 CYP1_BRUMA
38 PsiBlast_CBE 68.1345% -80 - C6 -1C5F 6.5 CYP1_BRUMA
37 PsiBlast_CBE 68.0045% -86 - C6 -1C5F 2.5 CYP1_BRUMA
20 PsiBlast_PDB 67.7745% -85 - C6 -1C5F 7.3 CYP1_BRUMA
42 PsiBlast_CBE 67.6847% -94 - C6 -1H0P 2.8 CYP5_CAEEL
61 PsiBlast_CBE 67.6144% -99 - C6 -3K2C 2.3 CYPH_ENCCU
68 PsiBlast_CBE 67.5940% -96 - C6 -4N1S 3.2 PPIA_HUMAN
100 PsiBlast_CBE 67.4640%-100 - C6 -2RMB 8.2 PPIA_HUMAN
47 PsiBlast_CBE 67.3746% -88 - C6 -4JJM 7.2 ?
62 PsiBlast_CBE 67.0844% -98 - C6 -3K2C 2.0 CYPH_ENCCU
77 PsiBlast_CBE 66.6940%-101 - C6 -3ODL 7.8 PPIA_HUMAN
66 PsiBlast_CBE 66.4840% -92 - C6 -3RDD 4.0 PPIA_HUMAN
122 HHSearch 66.4639%-103 - C6 -3S6M 2.5 ?
94 PsiBlast_CBE 66.4240% -99 - C6 -3ODI 3.0 PPIA_HUMAN
74 PsiBlast_CBE 66.3740% -97 - C6 -4IPZ 8.1 PPIA_HUMAN
99 PsiBlast_CBE 66.3540%-100 - C6 -2RMB 7.7 PPIA_HUMAN
102 PsiBlast_CBE 66.3040% -98 - C6 -2RMB 0.7 PPIA_HUMAN
91 PsiBlast_CBE 66.2240%-101 - C6 -3ODI 3.0 PPIA_HUMAN
101 PsiBlast_CBE 66.2040% -98 - C6 -2RMB 3.3 PPIA_HUMAN
24 PsiBlast_CBE 66.1246% -90 - C6 -2RMC 7.7 PPIC_MOUSE
82 PsiBlast_CBE 66.0040% -98 - C6 -3ODL 3.0 PPIA_HUMAN
40 PsiBlast_CBE 65.8944% -87 - C6 -1CYN 7.4 PPIB_HUMAN
46 PsiBlast_CBE 65.8346% -84 - C6 -4JJM 6.5 ?
75 PsiBlast_CBE 65.7740%-100 - C6 -3ODL 7.4 PPIA_HUMAN
93 PsiBlast_CBE 65.7640%-101 - C6 -3ODI 3.1 PPIA_HUMAN
84 PsiBlast_CBE 65.6540% -97 - C6 -3ODL 3.1 PPIA_HUMAN
81 PsiBlast_CBE 65.6240% -97 - C6 -3ODL 3.1 PPIA_HUMAN
78 PsiBlast_CBE 65.6240% -98 - C6 -3ODL 7.6 PPIA_HUMAN
80 PsiBlast_CBE 65.6040% -97 - C6 -3ODL 3.1 PPIA_HUMAN
98 PsiBlast_CBE 65.5540% -96 - C6 -2RMB 7.4 PPIA_HUMAN
25 PsiBlast_CBE 65.4246% -92 - C6 -2RMC 7.6 PPIC_MOUSE
16 PsiBlast_PDB 65.2046% -90 - C6 -2RMC 7.6 PPIC_MOUSE
88 PsiBlast_CBE 65.1440% -99 - C6 -3ODI 7.7 PPIA_HUMAN
116 HHSearch 65.1140%-102 - C6 -1LOP 5.1 PPIB_ECOLI
76 PsiBlast_CBE 65.1040% -97 - C6 -3ODL 7.5 PPIA_HUMAN
73 PsiBlast_CBE 65.0540% -94 - C6 -4N1N 3.1 PPIA_HUMAN
96 PsiBlast_CBE 65.0340% -96 * C6 *2RMB 8.0 PPIA_HUMAN
89 PsiBlast_CBE 64.9940%-100 - C6 -3ODI 7.8 PPIA_HUMAN
69 PsiBlast_CBE 64.9240% -94 - C6 -4N1R 3.0 PPIA_HUMAN
71 PsiBlast_CBE 64.9140% -99 - C6 -4N1P 2.8 PPIA_HUMAN
67 PsiBlast_CBE 64.8640% -92 - C6 -4N1M 3.3 PPIA_HUMAN
85 PsiBlast_CBE 64.8040% -97 - C6 -3ODI 7.7 PPIA_HUMAN
72 PsiBlast_CBE 64.7640% -92 - C6 -4N1O 3.2 PPIA_HUMAN
23 PsiBlast_CBE 64.7046% -89 - C6 -2RMC 7.8 PPIC_MOUSE
83 PsiBlast_CBE 64.6940% -98 - C6 -3ODL 3.1 PPIA_HUMAN
87 PsiBlast_CBE 64.6140% -95 - C6 -3ODI 7.9 PPIA_HUMAN
70 PsiBlast_CBE 64.6140% -93 - C6 -4N1Q 3.4 PPIA_HUMAN
79 PsiBlast_CBE 64.4140% -97 - C6 -3ODL 7.7 PPIA_HUMAN
90 PsiBlast_CBE 64.1240% -95 - C6 -3ODI 3.1 PPIA_HUMAN
31 PsiBlast_CBE 64.0947% -86 - C6 -3EOV 5.2 ?
86 PsiBlast_CBE 64.0340% -98 - C6 -3ODI 7.5 PPIA_HUMAN
97 PsiBlast_CBE 63.9840% -98 - C6 -2RMB 7.8 PPIA_HUMAN
92 PsiBlast_CBE 63.7740% -95 - C6 -3ODI 3.0 PPIA_HUMAN
124 Fugue 63.5742% -77 - C6 -2RMC 7.0 PPIC_MOUSE
32 PsiBlast_CBE 62.1447% -86 - C6 -3EOV 5.4 ?
49 PsiBlast_CBE 61.3045% -77 - C6 -1XQ7 5.1 ?
48 PsiBlast_CBE 60.4645% -75 - C6 -1XQ7 6.8 ?
95 PsiBlast_CBE 60.1840% -94 - C6 -3CYS 4.4 PPIA_HUMAN
50 PsiBlast_CBE 59.6145% -79 - C6 -1XQ7 6.3 ?