@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1227: (2016-03-22 )
MIKLGNDWDELLKNEFNQPYYLTLRQFLKKEYQTKKVFPDMYDIFNALKHTAYKDVKVVILGQDPYHGPGQAHGLSFSVQQGVQIPPSLQNIYLELHNDLNCEIPNNGYLIPWADQGVLLLNTVLTVRAGQANSHRGQGWEILTNHIIEIINQKEEPVVFLLWGSNAKEKLQLLTNPKHTAFTSVHPSPLSASRGFMGCKHFSKTNQFLEQNGVKPIDWQIPSI

Atome Classification :

(57 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FCF_A_2(3FCF)
UNG_HUMAN
[Raw transfer]




302_B_2(2HXM)
UNG_HUMAN
[Raw transfer]




3FI_A_2(3FCI)
UNG_HUMAN
[Raw transfer]




3FI_A_2(3FCI)
UNG_HUMAN
[Raw transfer]




5NU_A_2(4WS5)
?
[Raw transfer]




URA_B_2(5EUG)
UNG_ECOLI
[Raw transfer]




3FL_B_8(3FCL)
UNG_HUMAN
[Raw transfer]




3FL_A_3(3FCL)
UNG_HUMAN
[Raw transfer]




URA_B_2(2EUG)
UNG_ECOLI
[Raw transfer]




URA_A_2(4WPL)
?
[Raw transfer]




URA_A_2(4WRU)
?
[Raw transfer]




GOL_B_2(3EUG)
UNG_ECOLI
[Raw transfer]




GOL_B_5(1OKB)
?
[Raw transfer]




GOL_A_3(1OKB)
?
[Raw transfer]




URF_A_2(4WS1)
?
[Raw transfer]




URF_A_2(4WS0)
?
[Raw transfer]




URA_A_2(4WRV)
?
[Raw transfer]




GOL_A_8(4WRW)
?
[Raw transfer]




5UC_A_2(4WS7)
?
[Raw transfer]




URA_D_4(1UDH)
UNG_HHV11
[Raw transfer]




URA_B_2(1FLZ)
UNG_ECOLI
[Raw transfer]




DUR_A_2(2C53)
UNG_HHV11
[Raw transfer]




FCK_B_2(3FCK)
UNG_HUMAN
[Raw transfer]




6UA_A_2(4WS3)
?
[Raw transfer]




GOL_A_4(3ZOQ)
UNG_BACSU
[Raw transfer]




URB_A_3(3CXM)
?
[Raw transfer]




URB_A_3(3CXM)
?
[Raw transfer]




TUL_A_2(4WS8)
?
[Raw transfer]




NACID_B_2(4UQM)
?
[Raw transfer]

-

CHAIN_B_1(2OYT)
UNG_HUMAN
[Raw transfer]

-

CIT_A_3(4WS4)
?
[Raw transfer]




FLC_A_2(3A7N)
UNG_MYCTU
[Raw transfer]




CIT_A_2(4WRY)
?
[Raw transfer]




CIT_A_2(4WPK)
?
[Raw transfer]




CIT_A_4(4WS6)
?
[Raw transfer]




CIT_A_3(4WS2)
?
[Raw transfer]




NACID_D_1(1LAU)
UNG_HHV11
[Raw transfer]

-

NACID_A_1(2SSP)
UNG_HUMAN
[Raw transfer]

-

CIT_A_2(4WRZ)
?
[Raw transfer]




NACID_B_1(1EMJ)
UNG_HUMAN
[Raw transfer]

-

NACID_A_1(1SSP)
UNG_HUMAN
[Raw transfer]

-

NACID_B_2(4SKN)
UNG_HUMAN
[Raw transfer]

-

NACID_C_2(1EMH)
UNG_HUMAN
[Raw transfer]

-

DMS_A_5(4WPL)
?
[Raw transfer]




CHAIN_C_3(3UF7)
UNG_ECOLI
[Raw transfer]

-

CHAIN_C_3(3UF7)
UNG_ECOLI
[Raw transfer]

-

NACID_B_1(1EMH)
UNG_HUMAN
[Raw transfer]

-

NACID_B_1(2OXM)
UNG_HUMAN
[Raw transfer]

-

NACID_B_1(1Q3F)
UNG_HUMAN
[Raw transfer]

-

1 PsiBlast_PDB 98.0357% -99 - C8 -3ZOQ 2.6 UNG_BACSU
2 PsiBlast_PDB 97.9257% -95 - C8 -3ZOR - UNG_BACSU -
17 PsiBlast_PDB 94.5056%-106 - C8 -4EUG - UNG_ECOLI -
4 PsiBlast_PDB 94.0955% -86 - C8 -2BOO - UNG_DEIRA -
18 PsiBlast_PDB 93.9856%-103 - C8 -5EUG 3.3 UNG_ECOLI
66 Fugue 93.8755% -95 - C8 -1UUG - UNG_ECOLI -
14 PsiBlast_PDB 93.8256%-101 - C8 -2EUG 3.3 UNG_ECOLI
6 PsiBlast_PDB 93.7956%-101 - C8 -1EUG - UNG_ECOLI -
15 PsiBlast_PDB 93.4556%-102 - C8 -3EUG 2.6 UNG_ECOLI
3 PsiBlast_PDB 93.4455% -88 - C8 -3UFM - UNG_DEIRA -
20 PsiBlast_PDB 93.3753% -98 - C8 -2JHQ - UNG_VIBCH -
37 PsiBlast_CBE 93.2150% -86 - C8 -1OKB 3.2 ?
5 PsiBlast_PDB 93.1154% -79 - C8 -4UQM 8.8 ?
12 PsiBlast_PDB 92.9456%-101 - C8 -3UF7 5.5 UNG_ECOLI
19 PsiBlast_PDB 92.6356% -99 - C8 -2UUG - UNG_ECOLI -
36 PsiBlast_CBE 92.3950% -86 - C8 -1OKB 3.1 ?
75 HHSearch 92.3754% -87 - C8 -3TR7 - UNG_COXBU -
7 PsiBlast_PDB 92.3556%-101 - C8 -1UUG - UNG_ECOLI -
77 HHSearch 92.0955% -87 - C8 -3UF7 5.5 UNG_ECOLI
76 HHSearch 91.7551% -87 * C8 *3FCI 6.4 UNG_HUMAN
26 PsiBlast_CBE 91.2451% -88 - C8 -3FCF 7.2 UNG_HUMAN
29 PsiBlast_CBE 91.0251% -88 - C8 -2HXM 7.4 UNG_HUMAN
23 PsiBlast_CBE 91.0251% -84 - C8 -3FCL 5.7 UNG_HUMAN
25 PsiBlast_CBE 90.9651% -89 - C8 -3FCI 6.4 UNG_HUMAN
24 PsiBlast_CBE 90.9651% -88 - C8 -3FCK 4.5 UNG_HUMAN
22 PsiBlast_CBE 90.9051% -86 - C8 -3FCL 5.8 UNG_HUMAN
33 PsiBlast_CBE 90.8351% -86 - C8 -1EMH 10.8 UNG_HUMAN
16 PsiBlast_PDB 90.7656% -99 - C8 -1FLZ 3.6 UNG_ECOLI
38 PsiBlast_CBE 90.5041% -92 - C8 -3CXM 3.3 ?
30 PsiBlast_CBE 90.1451% -84 - C8 -1SSP 7.6 UNG_HUMAN
27 PsiBlast_CBE 90.1451% -85 - C8 -2OYT 9.2 UNG_HUMAN
32 PsiBlast_CBE 90.0951% -84 - C8 -1EMJ 8.9 UNG_HUMAN
31 PsiBlast_CBE 89.2351% -85 - C8 -1Q3F 9.3 UNG_HUMAN
34 PsiBlast_CBE 88.7850% -80 - C8 -2SSP 6.1 UNG_HUMAN
28 PsiBlast_CBE 88.3251% -81 - C8 -2OXM 6.1 UNG_HUMAN
35 PsiBlast_CBE 87.8850% -81 - C8 -4SKN 3.4 UNG_HUMAN
79 HHSearch 86.2642% -80 - C8 -3CXM 3.3 ?
47 PsiBlast_CBE 86.2345% -87 - C8 -4WS7 3.3 ?
49 PsiBlast_CBE 86.0045% -96 - C8 -4WS5 3.9 ?
54 PsiBlast_CBE 85.6045% -89 - C8 -4WS0 2.6 ?
53 PsiBlast_CBE 85.4745% -88 - C8 -4WS1 3.2 ?
60 PsiBlast_CBE 85.0745% -89 - C8 -4WRU 3.5 ?
56 PsiBlast_CBE 85.0145% -86 - C8 -4WRY 3.1 ?
48 PsiBlast_CBE 84.9645% -87 - C8 -4WS6 2.9 ?
62 PsiBlast_CBE 84.8645% -87 - C8 -4WPK 2.9 ?
63 PsiBlast_CBE 84.8045% -95 - C8 -3A7N 2.5 UNG_MYCTU
61 PsiBlast_CBE 84.5845% -91 - C8 -4WPL 3.5 ?
55 PsiBlast_CBE 84.5745% -88 - C8 -4WRZ 2.8 ?
46 PsiBlast_CBE 84.4945% -92 - C8 -4WS8 3.1 ?
52 PsiBlast_CBE 84.2845% -86 - C8 -4WS2 2.9 ?
41 PsiBlast_CBE 83.9538% -97 - C8 -1UDH 3.5 UNG_HHV11
51 PsiBlast_CBE 83.8945% -92 - C8 -4WS3 3.6 ?
59 PsiBlast_CBE 83.8345% -93 - C8 -4WRV 3.4 ?
65 PsiBlast_CBE 83.7637% -99 - C8 -2C53 4.0 UNG_HHV11
50 PsiBlast_CBE 83.6845% -86 - C8 -4WS4 2.9 ?
43 PsiBlast_CBE 83.2138%-100 - C8 -1LAU 5.8 UNG_HHV11
58 PsiBlast_CBE 82.5845% -89 - C8 -4WRW 2.5 ?