@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu00910: (2016-06-02 )
MFRIGQGFDVHQLVEGRPLIIGGIEIPYEKGLLGHSDADVLLHTVADACLGAVGEGDIGKHFPDTDPEFKDADSFKLLQHVWGIVKQKGYVLGNIDCTIIAQKPKMLPYIEDMRKRIAEGLEADVSQVNVKATTTEKLGFTGRAEGIAAQATVLIQKG

Atome Classification :

(89 SA) .........10....----....20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MFRIGQGFDVHQLVE----GRPLIIGGIEIPYEKGLLGHSDADVLLHTVADACLGAVGEGDIGKHFPDTDPEFKDADSFKLLQHVWGIVKQKGYVLGNIDCTIIAQKPKMLPYIEDMRKRIAEGLEADVSQVNVKATTTEKLGFTGRAEGIAAQATVLIQKG
102 HHSearch 96.3862%-116 - C10 -1T0A ISPF_SHEON A:[2-159] KIRIGHGFDVHKFGE----PRPLILCGVEVPYETGLVAHSDGDVVLHAISDAILGAMALGDIGKHFPDTDAAYKGADSRVLLRHCYALAKAKGFELGNLDVTIIAQAPKMAPHIEDMRQVLAADLNADVADINVKATTTEKLGFTGRKEGIAVEAVVLLSRQ
5 PsiBlast_PDB 96.1961%-125 - C10 -3F0G ISPF_BURP1 A:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
3 PsiBlast_PDB 96.0961%-127 - C10 -3F0E ISPF_BURP1 A:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
79 PsiBlast_CBE 95.9563%-117 - C10 -3T80 ISPF_SALTY A:[4-159] -MRIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDEVNVKATTTEKLGFTGRGEGIACEAVALLMK-
6 PsiBlast_PDB 95.9361%-128 - C10 -3IEQ ISPF_BURP1 A:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
84 PsiBlast_CBE 95.8763%-118 - C10 -3ESJ ISPF_ECOLI A:[7-163] -MRIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKA
8 PsiBlast_PDB 95.8661%-124 - C10 -3JVH ISPF_BURP1 A:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
80 PsiBlast_CBE 95.8563%-116 - C10 -3GHZ ISPF_SALTY C:[4-159] -MRIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDEVNVKATTTEKLGFTGRGEGIACEAVALLMK-
9 PsiBlast_PDB 95.7961%-127 - C10 -3K14 ISPF_BURP1 A:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
4 PsiBlast_PDB 95.6061%-123 - C10 -3F0F ISPF_BURP1 A:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
1 PsiBlast_PDB 95.5961%-116 - C10 -1T0A ISPF_SHEON A:[3-158] -IRIGHGFDVHKFGE----PRPLILCGVEVPYETGLVAHSDGDVVLHAISDAILGAMALGDIGKHFPDTDAAYKGADSRVLLRHCYALAKAKGFELGNLDVTIIAQAPKMAPHIEDMRQVLAADLNADVADINVKATTTEKLGFTGRKEGIAVEAVVLLSR-
16 PsiBlast_PDB 95.5561%-125 - C10 -3QHD ISPF_BURP1 A:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
17 PsiBlast_PDB 95.5361%-124 - C10 -3IKE ISPF_BURPS A:[7-162] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
14 PsiBlast_PDB 95.4361%-125 - C10 -3P10 ISPF_BURP1 A:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
90 PsiBlast_CBE 95.3963%-116 - C10 -3ERN ISPF_ECOLI A:[7-162] -MRIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK-
124 Fugue 95.3863%-122 * C10 *1JY8 ISPF_ECOLI A:[1-155] -MRIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLI--
13 PsiBlast_PDB 95.3861%-125 - C10 -3P0Z ISPF_BURP1 A:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
54 PsiBlast_CBE 95.2561%-122 - C10 -3F0D ISPF_BURP1 D:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSD--PRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
7 PsiBlast_PDB 95.2561%-127 - C10 -3IEW ISPF_BURPS A:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
45 PsiBlast_CBE 95.2361%-123 - C10 -3F0G ISPF_BURP1 D:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
18 PsiBlast_PDB 95.2261%-127 - C10 -3IKF ISPF_BURPS A:[7-162] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
100 PsiBlast_CBE 94.9863%-116 - C10 -2AMT ISPF_ECOLI A:[1-156] -MRIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK-
21 PsiBlast_CBE 94.9761%-126 - C10 -3QHD ISPF_BURP1 C:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
87 PsiBlast_CBE 94.9563%-116 - C10 -3ERN ISPF_ECOLI D:[7-162] -MRIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK-
92 PsiBlast_CBE 94.9463%-120 - C10 -3ELC ISPF_ECOLI C:[7-162] -MRIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK-
98 PsiBlast_CBE 94.9363%-114 - C10 -2AMT ISPF_ECOLI C:[1-156] -MRIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK-
82 PsiBlast_CBE 94.9363%-115 - C10 -3GHZ ISPF_SALTY A:[4-159] -MRIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDEVNVKATTTEKLGFTGRGEGIACEAVALLMK-
12 PsiBlast_PDB 94.9361%-123 - C10 -3MBM ISPF_BURP1 A:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
99 PsiBlast_CBE 94.6063%-116 - C10 -2AMT ISPF_ECOLI B:[1-156] -MRIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK-
101 PsiBlast_CBE 94.5463%-113 - C10 -1U43 ISPF_ECOLI A:[1-155] -MRIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLI--
93 PsiBlast_CBE 94.5063%-120 - C10 -3ELC ISPF_ECOLI B:[7-162] -MRIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK-
66 PsiBlast_CBE 94.5061%-120 - C10 -4C8I ISPF_BURCJ B:[25-179] --RIGQGYDVHQLVE----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDAAFKGADSRVLLRACAERVKAAGFTIQNVDSTVIAQAPKLAPHIDGMRANIAADLGLPLERVNVKAKTNEKLGYLGRGEGIEAQAAALLVK-
95 PsiBlast_CBE 94.4763%-115 - C10 -2AMT ISPF_ECOLI F:[1-156] -MRIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK-
49 PsiBlast_CBE 94.3961%-126 - C10 -3F0F ISPF_BURP1 B:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
89 PsiBlast_CBE 94.3663%-117 - C10 -3ERN ISPF_ECOLI B:[7-162] -MRIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK-
23 PsiBlast_CBE 94.3561%-126 - C10 -3Q8H ISPF_BURPS C:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
10 PsiBlast_PDB 94.3261%-127 - C10 -3K2X ISPF_BURP1 A:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSD----FKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
26 PsiBlast_CBE 94.2261%-127 - C10 -3P10 ISPF_BURP1 B:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
94 PsiBlast_CBE 94.0763%-119 - C10 -3ELC ISPF_ECOLI A:[7-162] -MRIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK-
96 PsiBlast_CBE 93.9263%-115 - C10 -2AMT ISPF_ECOLI E:[1-156] -MRIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK-
37 PsiBlast_CBE 93.8361%-127 - C10 -3JVH ISPF_BURP1 C:[24-179] -FRIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHF------FKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR-
108 HHSearch 93.7960%-126 - C10 -4C8E ISPF_BURCJ A:[23-180] DVRIGQGYDVHQLVE----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDAAFKGADSRVLLRACAERVKAAGFTIQNVDSTVIAQAPKLAPHIDGMRANIAADLGLPLERVNVKAKTNEKLGYLGRGEGIEAQAAALLVKQ