@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv2697c: (2016-05-13 )
MSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLASTSRGDGGHGSSGGHASL

Atome Classification :

(80 SA) .........10--...----.....20........30.--.----...--...40........50...--....--------..60........70..-......80........90.....-------------.-.-.--------------------------100.------------......110......-.120........130.......140.......150..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSTTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSFDEAGLASTSRGDGGHGSSGGHASL
121 HHSearch 96.0399%-139 - C4 -3HZA DUT_MYCTU A:[22-174] -STTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-DPA--------------------------A-PI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSFDEAGLASTSRGDGGWGSSGGHASL
9 PsiBlast_PDB 96.0299%-139 - C4 -3HZA DUT_MYCTU A:[21-174] MSTTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSFDEAGLASTSRGDGGWGSSGGHASL
11 PsiBlast_PDB 95.8699%-142 - C4 -3LOJ DUT_MYCTU A:[21-174] MSTTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSFDEAGLASTSRGDGGAGSSGGHASL
7 PsiBlast_PDB 94.63100%-137 - C4 -2PY4 DUT_MYCTU A:[22-174] -STTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSFDEAGLASTSRGDGGHGSSGGHASL
10 PsiBlast_PDB 94.6299%-140 - C4 -4GCY DUT_MYCTU A:[21-174] MSTTLAIVRLD--PGL----PLPSRAWDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSFDEAGLASTSRGDGGHGSSGGHASL
2 PsiBlast_PDB 92.15100%-144 - C4 -1SIX DUT_MYCTU A:[21-164] MSTTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSFDEAGLASTSRGDGG----------
1 PsiBlast_PDB 91.47100%-151 - C4 -1MQ7 DUT_MYCTU A:[2-135] -STTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSFDEAGL-------------------
27 PsiBlast_CBE 91.31100%-150 - C4 -1SLH DUT_MYCTU B:[23-162] --TTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSFDEAGLASTSRGD------------
26 PsiBlast_CBE 90.82100%-156 - C4 -1SLH DUT_MYCTU C:[21-150] MSTTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSF------------------------
29 PsiBlast_CBE 90.38100%-147 - C4 -1SJN DUT_MYCTU B:[1-140] MSTTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSFDEAGLASTSR--------------
122 HHSearch 90.17100%-151 - C4 -1SJN DUT_MYCTU A:[2-132] -STTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-PA-------------------------A-PI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSFDE----------------------
23 PsiBlast_CBE 90.16100%-153 - C4 -1SMC DUT_MYCTU C:[22-150] -STTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSF------------------------
6 PsiBlast_PDB 89.97100%-151 - C4 -1SNF DUT_MYCTU A:[22-152] -STTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSFDE----------------------
3 PsiBlast_PDB 89.95100%-151 - C4 -1SLH DUT_MYCTU A:[22-156] -STTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSFDEAGLA------------------
8 PsiBlast_PDB 89.53100%-150 - C4 -1SJN DUT_MYCTU A:[2-132] -STTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSFDE----------------------
4 PsiBlast_PDB 89.48100%-152 - C4 -1SM8 DUT_MYCTU A:[22-152] -STTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSFDE----------------------
22 PsiBlast_CBE 89.35100%-148 - C4 -1SNF DUT_MYCTU B:[21-156] MSTTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSFDEAGLA------------------
21 PsiBlast_CBE 89.26100%-155 - C4 -1SNF DUT_MYCTU C:[22-150] -STTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSF------------------------
25 PsiBlast_CBE 89.05100%-149 - C4 -1SM8 DUT_MYCTU B:[21-156] MSTTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSFDEAGLA------------------
24 PsiBlast_CBE 89.04100%-153 - C4 -1SM8 DUT_MYCTU C:[22-150] -STTLAIVRLD--PGL----PLPSRAHDGDAGVDLYSA--E----DVE--LAPGRRALVRTGVA-VAV--PFGM--------VGLVHPRSGLATRVGL-SIVNSPGTIDAGYRGEIKVALIN-------------L-D-P--------------------------AAPI------------VVHRGDRIAQLLVQR-VEL-VELVEVSSF------------------------
126 HHSearch 75.9039%-155 - C4 -4GV8 ? A:[3-155] --NTLQVRLLS--ENA----RMPERNHKTDAGYDIFSA--E----TVV--LEPQEKAVIKTDVA-VSI--PEGY--------VGLLTSRSGVSSKTHL-VIE--TGKIDAGYHGNLGINIKN-------------D-A-IASNGYITPGVFDIKGEIDLSDAIRQYG-TY------------QINEGDKLAQLVIVP-IWT-PELKQVEEF----ES------------------
81 PsiBlast_CBE 74.0838%-135 - C4 -4OOP DUT_ARATH B:[26-165] -SPFFKVKKLS--EKA----VIPTRGSPLSAGYDLSSA--V----DSK--VPARGKALIPTDLS-IAV--PEGT--------YARIAPRSGLAWKHSI-DV--GAGVIDADYRGPVGVILFN-------------H-S----------------------------DADF------------EVKFGDRIAQLIIEK-IVT-PDVVEVDDLDE-----TVRGDGGFGSTG-----
40 PsiBlast_CBE 72.9343%-149 - C4 -3MBQ DUT_BRUA2 C:[31-172] ---TLGIIRLEHAKGL----DLPAYETAGSAGMDLRAAVAE----DRQIVLLPGRRTLVPTGLI-LEI--PQGY--------EVQIRPRSGLAFKNGI-TCLNTPGTIDSDYRGEVKVLLIN-------------L-G-D---------------------------DDF------------RIERGMRIAQAV------F-APVIQPKIEERAKI-----GAGGF---------
58 PsiBlast_CBE 72.5839%-141 - C4 -2HQU DUT_HUMAN A:[26-164] ----LRFARLS--EHA----TAPTR---RAAGYDLYSA--Y----DYT--IPPMEKAVVKTDIQ-IAL--PSGC--------YGRVAPRSGLAAKHFI-DV--GAGVIDEDYRGNVGVVLFN-------------F-G----------------------------KEKF------------EVKKGDRIAQLICER-IFY-PEIEEVQALDD-----TERGSGGFGSTGKN---
43 PsiBlast_CBE 72.4239%-144 - C4 -1Q5H DUT_HUMAN B:[9-142] ----LRFARLS--EHA----TAPTRGSARAAGYDLYSA--Y----DYT--IPPMEKAVVKTDIQ-IAL--PSGC--------YGRVAPRSGLAAKHFI-DV--GAGVIDEDYRGNVGVVLFN-------------F-G-K---------------------------EKF------------EVKKGDRIAQLICER-IFY-PEIEEVQALDD-----TERGSGGFG--------
45 PsiBlast_CBE 72.0239%-135 - C4 -3EHW DUT_HUMAN Z:[26-164] ----LRFARLS--EHA----TAPTRGSARAAGYDLYSA--Y----DYT--IPPMEKAVVKTDIQ-IAL--PSGC--------YGRVAPRSGLAAKHFI-DV--GAGVIDEDYRGNVGVVLFN-------------F-G----------------------------KEKF------------EVKKGDRIAQLICER-IFY-PEIEEVQALDD-----TERGSGGFGSTGKN---
57 PsiBlast_CBE 71.9739%-139 - C4 -2HQU DUT_HUMAN B:[26-164] ----LRFARLS--EHA----TAPTRGSARAAGYDLYSA--Y----DYT--IPPMEKAVVKTDIQ-IAL--PSGC--------YGRVAPRSGLAAKHFI-DV--GAGVIDEDYRGNVGVVLFN-------------F-G----------------------------KEKF------------EVKKGDRIAQLICER-IFY-PEIEEVQALDD-----TERGSGGFGSTGKN---
50 PsiBlast_CBE 71.9639%-138 - C4 -3EHW DUT_HUMAN A:[26-164] ----LRFARLS--EHA----TAPTRGSARAAGYDLYSA--Y----DYT--IPPMEKAVVKTDIQ-IAL--PSGC--------YGRVAPRSGLAAKHFI-DV--GAGVIDEDYRGNVGVVLFN-------------F-G----------------------------KEKF------------EVKKGDRIAQLICER-IFY-PEIEEVQALDD-----TERGSGGFGSTGKN---
127 HHSearch 71.7145%-133 - C4 -3MDX DUT_BRUA2 A:[30-172] --PTLGIIRLEHAKGL----DLPAYETAGSAGMDLRAA--VAEDRQIV--LLPGRRTLVPTGLI-LEI--PQGY--------EVQIRPRSGLAFKNGI-TCLNTPGTIDSDYRGEVKVLLIN-------------L-G-D--------------------------D-DF------------RIERGMRIAQAVFAP-VIQ-PKIEERAK----------RGAGGF---------
82 PsiBlast_CBE 71.6938%-138 - C4 -4OOP DUT_ARATH A:[26-157] -SPFFKVKKLS--EKA----VIPTRGSPLSAGYDLSSA--V----DSK--VPARGKALIPTDLS-IAV--PEGT--------YARIAPRSGLAWKHSI-DV--GAGVIDADYRGPVGVILFN-------------H-S----------------------------DADF------------EVKFGDRIAQLIIEK-IVT-PDVVEVDDLDE-----TVRG-------------
20 PsiBlast_PDB 71.5443%-145 - C4 -3MDX DUT_BRUA2 A:[31-172] ---TLGIIRLEHAKGL----DLPAYETAGSAGMDLRAAVAE----DRQIVLLPGRRTLVPTGLI-LEI--PQGY--------EVQIRPRSGLAFKNGI-TCLNTPGTIDSDYRGEVKVLLIN-------------L-G-D---------------------------DDF------------RIERGMRIAQAV------F-APVIQPKIEERAK-----RGAGGF---------
42 PsiBlast_CBE 71.5039%-143 - C4 -1Q5H DUT_HUMAN C:[9-142] ----LRFARLS--EHA----TAPTRGSARAAGYDLYSA--Y----DYT--IPPMEKAVVKTDIQ-IAL--PSGC--------YGRVAPRSGLAAKHFI-DV--GAGVIDEDYRGNVGVVLFN-------------F-G-K---------------------------EKF------------EVKKGDRIAQLICER-IFY-PEIEEVQALDD-----TERGSGGFG--------
48 PsiBlast_CBE 71.1839%-134 - C4 -3EHW DUT_HUMAN C:[26-164] ----LRFARLS--EHA----TAPTRGSARAAGYDLYSA--Y----DYT--IPPMEKAVVKTDIQ-IAL--PSGC--------YGRVAPRSGLAAKHFI-DV--GAGVIDEDYRGNVGVVLFN-------------F-G----------------------------KEKF------------EVKKGDRIAQLICER-IFY-PEIEEVQALDD-----TERGSGGFGSTGKN---
139 HHSearch 71.1739%-143 - C4 -4OOP DUT_ARATH A:[27-157] --PFFKVKKLS--EKA----VIPTRGSPLSAGYDLSSA--V----DSK--VPARGKALIPTDLS-IAV--PEGT--------YARIAPRSGLAWKHSI-DVG--AGVIDADYRGPVGVILFN-------------H-S-D--------------------------A-DF------------EVKFGDRIAQLIIEK-IVT-PDVVEVDD-----LDETVRG-------------
74 PsiBlast_CBE 71.0237%-141 - C4 -3C3I ? C:[2-137] --SSLLVKKLV--ESA----TTPMRGSEGAAGYDISSV--E----DVV--VPAMGRIAVSTGIS-IRV--PDGT--------YGRIAPRSGLAYKYGI-DVL--AGVIDSDYRGEVKVILYN-------------T---T--------------------------ERDY------------IIKKGDRIAQLILEQ-IVT-PGVAVVLD-----LSDTARGSGGFG--------
49 PsiBlast_CBE 70.9539%-135 - C4 -3EHW DUT_HUMAN B:[26-164] ----LRFARLS--EHA----TAPTRGSARAAGYDLYSA--Y----DYT--IPPMEKAVVKTDIQ-IAL--PSGC--------YGRVAPRSGLAAKHFI-DV--GAGVIDEDYRGNVGVVLFN-------------F-G----------------------------KEKF------------EVKKGDRIAQLICER-IFY-PEIEEVQALDD-----TERGSGGFGSTGKN---
80 PsiBlast_CBE 70.8338%-144 - C4 -4OOP DUT_ARATH C:[26-152] -SPFFKVKKLS--EKA----VIPTRGSPLSAGYDLSSA--V----DSK--VPARGKALIPTDLS-IAV--PEGT--------YARIAPRSGLAWKHSI-DV--GAGVIDADYRGPVGVILFN-------------H-S----------------------------DADF------------EVKFGDRIAQLIIEK-IVT-PDVVEVDDLD-----------------------
75 PsiBlast_CBE 70.2237%-146 - C4 -3C3I ? B:[2-137] --SSLLVKKLV--ESA----TTPMRGSEGAAGYDISSV--E----DVV--VPAMGRIAVSTGIS-IRV--PDGT--------YGRIAPRSGLAYKYGI-DVL--AGVIDSDYRGEVKVILYN-------------T---T--------------------------ERDY------------IIKKGDRIAQLILEQ-IVT-PGVAVVLD-----LSDTARGSGGFG--------
46 PsiBlast_CBE 70.1239%-132 - C4 -3EHW DUT_HUMAN Y:[26-164] ----LRFARLS--EHA----TAPTRGSARAAGYDLYSA--Y----DYT--IPPMEKAVVKTDIQ-IAL--PSGC--------YGRVAPRSGLAAKHFI-DV--GAGVIDEDYRGNVGVVLFN-------------F-G----------------------------KEKF------------EVKKGDRIAQLICER-IFY-PEIEEVQALDD-----TERGSGGFGSTGKN---
41 PsiBlast_CBE 69.8643%-143 - C4 -3MBQ DUT_BRUA2 B:[31-160] ---TLGIIRLEHAKGL----DLPAYETAGSAGMDLRAAVAE----DRQIVLLPGRRTLVPTGLI-LEI--PQGY--------EVQIRPRSGLAFKNGI-TCLNTPGTIDSDYRGEVKVLLIN-------------L-G-D---------------------------DDF------------RIERGMRIAQAV------F-APVIQPKIEERA---------------------
19 PsiBlast_PDB 69.6043%-145 - C4 -3MBQ DUT_BRUA2 A:[31-163] ---TLGIIRLEHAKGL----DLPAYETAGSAGMDLRAAVAE----DRQIVLLPGRRTLVPTGLI-LEI--PQGY--------EVQIRPRSGLAFKNGI-TCLNTPGTIDSDYRGEVKVLLIN-------------L-G-D---------------------------DDF------------RIERGMRIAQAV------F-APVIQPKIEERAKIS------------------
135 HHSearch 69.3245%-144 * C4 *2OL1 ? A:[8-131] --SPVRFVKET--NRA----KSPTRQSPGAAGYDLYSA--Y----DYT--IPPGERQLIKTDIS-MSM--PKFC--------YGRIAPRSGLSL-KGI-DIG--GGVIDEDYRGNIGVILIN-------------N-G-K--------------------------C-TF------------NVNTGDRIAQLIYQR-IYY-PELEEVQS-----L-------------------
54 PsiBlast_CBE 69.1739%-144 - C4 -3ARA DUT_HUMAN C:[26-148] ----LRFARLS--EHA----TAPTRGSARAAGYDLYSA--Y----DYT--IPPMEKAVVKTDIQ-IAL--PSGC--------YGRVAPRSGLAAKHFI-DV--GAGVIDEDYRGNVGVVLFN-------------F-G----------------------------KEKF------------EVKKGDRIAQLICER-IFY-PEIEEVQAL------------------------
73 PsiBlast_CBE 69.0237%-155 - C4 -3C3I ? D:[2-131] --SSLLVKKLV--ESA----TTPMRGSEGAAGYDISSV--E----DVV--VPAMGRIAVSTGIS-IRV--PDGT--------YGRIAPRSGLAYKYGI-DVL--AGVIDSDYRGEVKVILYN-------------T---T--------------------------ERDY------------IIKKGDRIAQLILEQ-IVT-PGVAVVLD-----LSDTAR--------------
65 PsiBlast_CBE 68.8933%-146 - C4 -4GV8 ? D:[3-154] --NTLQVRLLS--ENA----RMPERNHKTDAGYDIFSA--E----TVV--LEPQEKAVIKTDVA-VSI--PEGY--------VGLLTSRSGVSSKTHL-VI--ETGKIDAGYHGNLGINIKNDAIASNGYITPGVF-D-I--------------------------KGEIDLSDAIRQYGTYQINEGDKLAQLVIVP-IWT-PELKQVEEFE-----------------------