@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : gbs0014: (2015-11-27 )
MLENDIKKVLYSEEDIILKTKELGAKLTADYAGKNPLLVGVLKGSVPFMAELLKHIDTHVEIDFMVVSSYHGGTTSSGEVKILKDVDTNIEGRDVIFIEDIIDTGRTLKYLRDMFKYRQANSVKVATLFDKPEGRLVDIDADYVCYDIPNEFIVGFGLDYAENYRNLPYVGVLKEEIYSK

Atome Classification :

(90 SA) .........10........20........30------.-------..------...-..40........50.....---.---.---------.60------------........70........80......-..90........100.......110.......120.......130.......140.......150.......160.......170........180
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MLENDIKKVLYSEEDIILKTKELGAKLTADY------A-------GK------NPL-LVGVLKGSVPFMAELLKHI---D---T---------HVE------------IDFMVVSSYHGGTTSSGEVKILKDVD-TNIEGRDVIFIEDIIDTGRTLKYLRDMFKYRQANSVKVATLFDKPEGRLVDIDADYVCYDIPNEFIVGFGLDYAENYRNLPYVG-VLKEEIYSK
1 PsiBlast_PDB 93.2062%-134 - C4 -3H83 ? A:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDY------K-------NT------VPL-AIGVLKGAMPFMADLLKRT---D---T---------YLE------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVG-VLKPSVYS-
23 PsiBlast_CBE 92.6062%-134 - C4 -3KB8 ? B:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDY------K-------NT------VPL-AIGVLKGAMPFMADLLKRT---D---T---------YLE------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVG-VLKPSVYSN
3 PsiBlast_PDB 91.8862%-136 - C4 -3KB8 ? A:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDY------K-------NT------VPL-AIGVLKGAMPFMADLLKRT---D---T---------YLE------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVG-VLKPSVYS-
4 PsiBlast_PDB 91.7057%-135 - C4 -4RQB ? A:[10-185] ---NDLKEVLLTEEDIQNICKELGAQLTKDY------Q-------GK------PLV-CVGILKGSAMFMSDLIKRI---D---T---------HLS------------IDFMDVSSYHGGTESTGEVQIIKDLG-SSIENKDVLIIEDILETGTTLKSITELLQSRKVNSLEIVTLLDKPNRRKADIEAKYVGKKIPDEFVVGYGLDYRELYRNLPYIG-TLKPEVYSN
29 PsiBlast_CBE 91.5662%-129 - C4 -3H83 ? B:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDY------K-------NT------VPL-AIGVLKGAMPFMADLLKRT---D---T---------YLE------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVG-VLKPSVYS-
26 PsiBlast_CBE 91.4562%-132 - C4 -3HVU ? B:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDY------K-------NT------VPL-AIGVLKGAMPFMADLLKRT---D---T---------YLE------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVG-VLKPSVYS-
110 HHSearch 91.2362%-130 - C4 -3HVU ? A:[26-203] -MNQDIEKVLISEEQIQEKVLELGAIIAEDY------K-------NT------VPL-AIGVLKGAMPFMADLLKRT---D---T---------YLE------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVG-VLKPSVYS-
24 PsiBlast_CBE 91.1562%-129 - C4 -3HVU ? D:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDY------K-------NT------VPL-AIGVLKGAMPFMADLLKRT---D---T---------YLE------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVG-VLKPSVYS-
2 PsiBlast_PDB 91.1562%-130 - C4 -3HVU ? A:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDY------K-------NT------VPL-AIGVLKGAMPFMADLLKRT---D---T---------YLE------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVG-VLKPSVYS-
22 PsiBlast_CBE 90.6962%-128 - C4 -3KB8 ? C:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDY------K-------NT------VPL-AIGVLKGAMPFMADLLKRT---D---T---------YLE------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVG-VLKPSVYS-
21 PsiBlast_CBE 90.2562%-130 - C4 -3KB8 ? D:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDY------K-------NT------VPL-AIGVLKGAMPFMADLLKRT---D---T---------YLE------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVG-VLKPSVYS-
25 PsiBlast_CBE 90.2462%-131 - C4 -3HVU ? C:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDY------K-------NT------VPL-AIGVLKGAMPFMADLLKRT---D---T---------YLE------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVG-VLKPSVYS-
27 PsiBlast_CBE 90.1462%-131 - C4 -3H83 ? D:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDY------K-------NT------VPL-AIGVLKGAMPFMADLLKRT---D---T---------YLE------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVG-VLKPSVYS-
8 PsiBlast_PDB 89.1552%-130 - C4 -2GEB ? A:[10-184] ---EDIEEILITEEQLKAKVKELGEMITRDY------E-------GK------DLV-LIGVLKGAIMFMSGLSRAI---D---L---------PLS------------IDFLAVSSYGSSTKSSGIVKIIKDHD-IDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKVDYCGFKIPDKFVVGYGIDYAEKYRNLPFIG-VLKPELY--
7 PsiBlast_PDB 89.0053%-129 - C4 -1YFZ ? A:[30-204] ---EDIEEILITEEQLKAKVKELGEMITRDY------E-------GK------DLV-LIGVLKGAIMFMSGLSRAI---D---L---------PLS------------IDFLAVSSYGSSTKSSGIVKIIKDHD-IDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKVDYCGFKIPDKFVVGYGLDYAEKYRNLPFIG-VLKPELY--
6 PsiBlast_PDB 88.9753%-132 - C4 -1R3U ? A:[30-204] ---EDIEEILITEEQLKAKVKELGEMITRDY------E-------GK------DLV-LIGVLKGAIMFMSGLSRAI---D---L---------PLS------------IDFLAVSSYGSSTKSSGIVKIIKDHD-IDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKVDYCGFKIPDKFVVGYGLDYAEKYRNLPFIG-VLKPELY--
118 HHSearch 88.8352%-128 - C4 -2GEB ? A:[9-184] --MEDIEEILITEEQLKAKVKELGEMITRDY------E-------GK------DLV-LIGVLKGAIMFMSGLSRAI---D---L---------PLS------------IDFLAVSSYGSSTKSSGIVKIIKDHD-IDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKVDYCGFKIPDKFVVGYGIDYAEKYRNLPFIG-VLKPELY--
119 HHSearch 88.6353%-126 - C4 -1YFZ ? A:[29-204] --MEDIEEILITEEQLKAKVKELGEMITRDY------E-------GK------DLV-LIGVLKGAIMFMSGLSRAI---D---L---------PLS------------IDFLAVSSYGSSTKSSGIVKIIKDHD-IDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKVDYCGFKIPDKFVVGYGLDYAEKYRNLPFIG-VLKPELY--
37 PsiBlast_CBE 88.4048%-132 - C4 -4QYI ? E:[7-177] ----EIKDTLISEEQLQEKVKELALQIERDF------E-------GE------EIV-VIAVLKGSFVFAADLIRHI---K---N---------DVT------------IDFISASS----TETTGKVKLLKDID-VNITGKNVIVVEDIIDSGLTLHFLKDHFFMHKPKALKFCTLLDKPERRKVDLTAEYVGFQIPDEFIVGYGIDCAEKYRNLPFIASVVT------
28 PsiBlast_CBE 88.3462%-129 - C4 -3H83 ? C:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDY------K-------NT------VPL-AIGVLKGAMPFMADLLKRT---D---T---------YLE------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVG-VLKPSVYS-
34 PsiBlast_CBE 88.3348%-140 - C4 -3O7M ? D:[7-176] ----EIKDTLISEEQLQEKVKELALQIERDF------E-------GE------EIV-VIAVLKGSFVFAADLIRHI---K---N---------DVT------------IDFISASSY--------KVKLLKDID-VNITGKNVIVVEDIIDSGLTLHFLKDHFFMHKPKALKFCTLLDKPERRKVDLTAEYVGFQIPDEFIVGYGIDCAEKYRNLPFIASVV-------
10 PsiBlast_PDB 87.6948%-135 - C4 -3O7M ? A:[7-177] ----EIKDTLISEEQLQEKVKELALQIERDF------E-------GE------EIV-VIAVLKGSFVFAADLIRHI---K---N---------DVT------------IDFISASSYG-------KVKLLKDID-VNITGKNVIVVEDIIDSGLTLHFLKDHFFMHKPKALKFCTLLDKPERRKVDLTAEYVGFQIPDEFIVGYGIDCAEKYRNLPFIASVVT------
35 PsiBlast_CBE 87.5148%-138 - C4 -3O7M ? C:[7-176] ----EIKDTLISEEQLQEKVKELALQIERDF------E-------GE------EIV-VIAVLKGSFVFAADLIRHI---K---N---------DVT------------IDFISASSYG-------KVKLLKDID-VNITGKNVIVVEDIIDSGLTLHFLKDHFFMHKPKALKFCTLLDKPERRKVDLTAEYVGFQIPDEFIVGYGIDCAEKYRNLPFIASVV-------
30 PsiBlast_CBE 87.4353%-128 - C4 -1YFZ ? B:[30-204] ---EDIEEILITEEQLKAKVKELGEMITRDY------E-------GK------DLV-LIGVLKGAIMFMSGLSRAI---D---L---------PLS------------IDFLAVSSYGSSTKSSGIVKIIKDHD-IDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKVDYCGFKIPDKFVVGYGLDYAEKYRNLPFIG-VLKPELY--
50 PsiBlast_CBE 87.0543%-130 - C4 -1P18 ? B:[9-192] ------EKILFTEEEIRTRIKEVAKRIADDY------K-------GKGLRPYVNPLVLISVLRGSFMFTADLCRALCDFN---V---------PVR------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIV-VLRPEVYAE
56 PsiBlast_CBE 86.8443%-135 - C4 -1I14 ? B:[9-192] ------EKILFTEEEIRTRIKEVAKRIADDY------K-------GKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFN---V---------PVR------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVETALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIV-VLRPEVYAE
58 PsiBlast_CBE 86.8143%-132 - C4 -1I0L ? B:[9-192] ------EKILFTEEEIRTRIKEVAKRIADDY------K-------GKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFN---V---------PVR------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVNTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIV-VLRPEVYAE
45 PsiBlast_CBE 86.5344%-132 - C4 -1TC2 ? B:[9-192] ------EKILFTEEEIRTRIKEVAKRIADDY------K-------GKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFN---V---------PVR------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIV-VLRPEVYAE
62 PsiBlast_CBE 86.4443%-133 - C4 -1I13 ? B:[9-192] ------EKILFTEEEIRTRIKEVAKRIADDY------K-------GKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFN---V---------PVR------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVATALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIV-VLRPEVYAE
39 PsiBlast_CBE 86.4048%-131 - C4 -4QYI ? C:[7-176] ----EIKDTLISEEQLQEKVKELALQIERDF------E-------GE------EIV-VIAVLKGSFVFAADLIRHI---K---N---------DVT------------IDFISASSYGNQTETTGKVKLLKDID-VNITGKNVIVVEDIIDSGLTLHFLKDHFFMHKPKALKFCTLLDKPERRKVDLTAEYVGFQIPDEFIVGYGIDCAEKYRNLPFIASVV-------
60 PsiBlast_CBE 86.0443%-133 - C4 -1I0I ? B:[9-192] ------EKILFTEEEIRTRIKEVAKRIADDY------K-------GKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFN---V---------PVR------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVQTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIV-VLRPEVYAE
19 PsiBlast_PDB 86.0044%-133 - C4 -1P19 ? A:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDY------K-------GKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFN---V---------PVR------------MEFICVSSY--GLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIV-VLRPEVY--
47 PsiBlast_CBE 85.9344%-137 - C4 -1P19 ? C:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDY------K-------GKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFN---V---------PVR------------MEFICVSSYGE----SGQVRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIV-VLRPEVY--
49 PsiBlast_CBE 85.8544%-130 - C4 -1TC1 ? B:[8-189] ------EKILFTEEEIRTRIKEVAKRIADDY------K-------GKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFN---V---------PVR------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIV-VLRPEVY--
9 PsiBlast_PDB 85.0748%-130 - C4 -4QYI ? B:[7-176] ----EIKDTLISEEQLQEKVKELALQIERDF------E-------GE------EIV-VIAVLKGSFVFAADLIRHI---K---N---------DVT------------IDFISASSYGNQTETTGKVKLLKDID-VNITGKNVIVVEDIIDSGLTLHFLKDHFFMHKPKALKFCTLLDKPERRKVDLTAEYVGFQIPDEFIVGYGIDCAEKYRNLPFIASVV-------
55 PsiBlast_CBE 84.8643%-132 - C4 -1P17 ? A:[9-192] ------EKILFTEEEIRTRIKEVAKRIADDY------K-------GKGLRPYVNPLVLISVLRGSFMFTADLCRALCDFN---V---------PVR------------MEFICVSSYG---TSSGQVRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIV-VLRPEVYAE
57 PsiBlast_CBE 84.1043%-130 - C4 -1I14 ? A:[9-191] ------EKILFTEEEIRTRIKEVAKRIADDY------K-------GKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFN---V---------PVR------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVETALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIV-VLRPEVYA-
20 PsiBlast_PDB 84.0544%-135 - C4 -1TC1 ? A:[8-187] ------EKILFTEEEIRTRIKEVAKRIADDY------K-------GKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFN---V---------PVR------------MEFICVSSY---------VRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIV-VLRPE----
53 PsiBlast_CBE 83.8843%-132 - C4 -1P17 ? C:[9-192] ------EKILFTEEEIRTRIKEVAKRIADDY------K-------GKGLRPYVNPLVLISVLRGSFMFTADLCRALCDFN---V---------PVR------------MEFICVSSYGE---SSGQVRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIV-VLRPEVYAE
116 HHSearch 83.8443%-130 - C4 -1TC1 ? A:[4-187] --YEFAEKILFTEEEIRTRIKEVAKRIADDY------KGKGLRPYVN------PLV-LISVLKGSFMFTADLCRAL---C---DFNV------PVR------------MEFICVSSY---------VRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIV-VLRPE----
46 PsiBlast_CBE 83.7544%-132 - C4 -1P19 ? D:[9-192] ------EKILFTEEEIRTRIKEVAKRIADDY------K-------GKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFN---V---------PVR------------MEFICVS----------QVRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIV-VLRPEVYAE
61 PsiBlast_CBE 83.6843%-129 - C4 -1I0I ? A:[9-191] ------EKILFTEEEIRTRIKEVAKRIADDY------K-------GKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFN---V---------PVR------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVQTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIV-VLRPEVYA-
51 PsiBlast_CBE 83.5643%-130 - C4 -1P18 ? A:[9-191] ------EKILFTEEEIRTRIKEVAKRIADDY------K-------GKGLRPYVNPLVLISVLRGSFMFTADLCRALCDFN---V---------PVR------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIV-VLRPEVYA-